BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1010 (628 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase Ubp1|Schizos... 26 3.9 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 9.0 >SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase Ubp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 849 Score = 26.2 bits (55), Expect = 3.9 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 432 IKITPLTKRPELFQKQRLNLNRITTS-GQ*STIRNTLMCRPVKLWRGLY 575 I+I P +RP+LF + L++ R+ T RN + V+L++G+Y Sbjct: 390 IQIKPYFERPDLFDEHPLHVQRVANQCWDIHTKRNDSII--VQLFQGMY 436 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.0 bits (52), Expect = 9.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 364 IVFRGIVLEI*QLARMDVRHGDRSLRMF 281 I+ R ++ I +L D+RHG LR+F Sbjct: 648 ILLRFLLSRIEELGSSDIRHGSVLLRLF 675 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,476,747 Number of Sequences: 5004 Number of extensions: 48766 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -