BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1010 (628 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0081 + 22248963-22249016,22249120-22249165,22249259-222493... 38 0.005 01_05_0668 - 24147412-24147618,24148019-24148286,24149506-241497... 36 0.035 >05_05_0081 + 22248963-22249016,22249120-22249165,22249259-22249357, 22250178-22250337,22250858-22251128,22251295-22251486 Length = 273 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +2 Query: 452 ETPGAVPEAETQPQSN-HNFWTIEYYQKYFDVQTSEVVERIISSVLP 589 + PG + + + Q+N ++ + Y YF+V T VV+R+ISSV P Sbjct: 60 QPPGTPADGDVETQTNWKGYFNVASYAPYFNVDTDVVVDRLISSVYP 106 >01_05_0668 - 24147412-24147618,24148019-24148286,24149506-24149728, 24149822-24149996 Length = 290 Score = 35.5 bits (78), Expect = 0.035 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +2 Query: 509 WTIEYYQKYFDVQTSEVVERIISSVLPQKVSRNYFDEK 622 +++ Y+ YFDV TS+VVERI SV P R F EK Sbjct: 92 FSVAAYKPYFDVDTSDVVERIWESVFP---FRGTFTEK 126 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,668,190 Number of Sequences: 37544 Number of extensions: 257454 Number of successful extensions: 545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -