BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1010 (628 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC013014-1|AAH13014.1| 316|Homo sapiens Yip1 domain family, mem... 50 7e-06 BC000056-1|AAH00056.1| 316|Homo sapiens YIPF2 protein protein. 50 7e-06 BC064590-1|AAH64590.1| 306|Homo sapiens Yip1 domain family, mem... 43 0.001 D10704-1|BAA01547.1| 456|Homo sapiens choline kinase protein. 30 7.7 BC036471-1|AAH36471.1| 439|Homo sapiens choline kinase alpha pr... 30 7.7 >BC013014-1|AAH13014.1| 316|Homo sapiens Yip1 domain family, member 2 protein. Length = 316 Score = 50.0 bits (114), Expect = 7e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = +2 Query: 449 DETPGAVPEAETQPQSNHNFWTIEYYQKYFDVQTSEVVERIISSVLPQ 592 +E+ A E Q Q FWT YYQ +FDV TS+V++RI S+LP+ Sbjct: 58 EESDKAALLQEQQQQQQPGFWTFSYYQSFFDVDTSQVLDRIKGSLLPR 105 >BC000056-1|AAH00056.1| 316|Homo sapiens YIPF2 protein protein. Length = 316 Score = 50.0 bits (114), Expect = 7e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = +2 Query: 449 DETPGAVPEAETQPQSNHNFWTIEYYQKYFDVQTSEVVERIISSVLPQ 592 +E+ A E Q Q FWT YYQ +FDV TS+V++RI S+LP+ Sbjct: 58 EESDKAALLQEQQQQQQPGFWTFSYYQSFFDVDTSQVLDRIKGSLLPR 105 >BC064590-1|AAH64590.1| 306|Homo sapiens Yip1 domain family, member 1 protein. Length = 306 Score = 42.7 bits (96), Expect = 0.001 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = +2 Query: 506 FWTIEYYQKYFDVQTSEVVERIISSVLP 589 FWT EYYQ +FDV T +V +RI S+LP Sbjct: 76 FWTFEYYQTFFDVDTYQVFDRIKGSLLP 103 >D10704-1|BAA01547.1| 456|Homo sapiens choline kinase protein. Length = 456 Score = 29.9 bits (64), Expect = 7.7 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 336 FNNSPVWTFDMVTGHLECFLKYNFIRKTKSNKF*KISLYNIGL 208 FN P W F + +L+ L+ F +++ K K+ YN+ L Sbjct: 241 FNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPL 283 >BC036471-1|AAH36471.1| 439|Homo sapiens choline kinase alpha protein. Length = 439 Score = 29.9 bits (64), Expect = 7.7 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 336 FNNSPVWTFDMVTGHLECFLKYNFIRKTKSNKF*KISLYNIGL 208 FN P W F + +L+ L+ F +++ K K+ YN+ L Sbjct: 224 FNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPL 266 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,688,128 Number of Sequences: 237096 Number of extensions: 1515250 Number of successful extensions: 2754 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2754 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6804036910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -