BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1010 (628 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058677-1|AAL13906.1| 360|Drosophila melanogaster LD38670p pro... 45 7e-05 AE014298-1826|AAF48214.2| 360|Drosophila melanogaster CG4645-PA... 45 7e-05 >AY058677-1|AAL13906.1| 360|Drosophila melanogaster LD38670p protein. Length = 360 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/36 (50%), Positives = 29/36 (80%) Frame = +2 Query: 503 NFWTIEYYQKYFDVQTSEVVERIISSVLPQKVSRNY 610 + +TIEYYQ++F+V T V+ERI +S++P++ S NY Sbjct: 106 SLFTIEYYQQFFNVDTYMVLERIANSMIPKRASGNY 141 >AE014298-1826|AAF48214.2| 360|Drosophila melanogaster CG4645-PA protein. Length = 360 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/36 (50%), Positives = 29/36 (80%) Frame = +2 Query: 503 NFWTIEYYQKYFDVQTSEVVERIISSVLPQKVSRNY 610 + +TIEYYQ++F+V T V+ERI +S++P++ S NY Sbjct: 106 SLFTIEYYQQFFNVDTYMVLERIANSMIPKRASGNY 141 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,404,247 Number of Sequences: 53049 Number of extensions: 474712 Number of successful extensions: 963 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2600432100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -