BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1010 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27490.1 68418.m03286 integral membrane Yip1 family protein c... 37 0.010 At3g05280.1 68416.m00576 integral membrane Yip1 family protein c... 35 0.038 At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.1 At3g62380.1 68416.m07007 hypothetical protein weak similarity to... 30 1.1 At4g25930.1 68417.m03729 hypothetical protein contains Pfam prof... 30 1.4 At2g18180.1 68415.m02115 SEC14 cytosolic factor, putative / phos... 27 7.7 At1g04700.1 68414.m00467 protein kinase family protein low simil... 27 7.7 >At5g27490.1 68418.m03286 integral membrane Yip1 family protein contains Pfam domain, PF04893: Yip1 domain Length = 282 Score = 37.1 bits (82), Expect = 0.010 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 3/49 (6%) Frame = +2 Query: 485 QPQSN---HNFWTIEYYQKYFDVQTSEVVERIISSVLPQKVSRNYFDEK 622 +PQS+ H F T+ Y+ YFDV TS+VVER+ S+ P R F EK Sbjct: 74 EPQSSGWLHRF-TVGAYKPYFDVDTSDVVERLKESLFP---FRGTFTEK 118 >At3g05280.1 68416.m00576 integral membrane Yip1 family protein contains Pfam domain, PF04893: Yip1 domain Length = 281 Score = 35.1 bits (77), Expect = 0.038 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Frame = +2 Query: 485 QPQSN---HNFWTIEYYQKYFDVQTSEVVERIISSVLPQKVSRNYFDEK 622 +PQS H F T+ Y+ +FDV TS+VVER+ S+ P R F EK Sbjct: 73 EPQSGGWLHKF-TVGAYKPFFDVDTSDVVERLKESLFP---FRGTFTEK 117 >At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = -2 Query: 213 GLSKC*RRTLNSKLLLKYKNRYCFRPRNETL 121 GLS+ +RT N+KLLL NR C P E L Sbjct: 63 GLSETEKRTNNTKLLLTLLNRNCESPFRECL 93 >At3g62380.1 68416.m07007 hypothetical protein weak similarity to S locus F-box (SLF)-S2 protein [Antirrhinum hispanicum] GI:13161526 Length = 325 Score = 30.3 bits (65), Expect = 1.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 168 AITWNLMYDVNILTSQYCTVKFSKICLISFF 260 ++ W M+ VNIL++ F K+CL +++ Sbjct: 261 SVKWEKMFSVNILSTNCLDANFWKLCLAAYY 291 >At4g25930.1 68417.m03729 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 434 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = -3 Query: 515 LSRSCDSIEVESLLLEQLRAFRQRSNFD*KYYYYCIDLYVLPLHQYAQFAHCVPGNSPGN 336 L R+ + +E + Q FR +++ KY YY D+ L + A C+ +S + Sbjct: 15 LMRNHNKVETLVHMASQFMVFRAEESWEEKYVYYTEDIGDLCIFLGHSEAFCIQASSGSS 74 Query: 335 LT 330 LT Sbjct: 75 LT 76 >At2g18180.1 68415.m02115 SEC14 cytosolic factor, putative / phosphoglyceride transfer protein, putative contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminussimilar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus]; Length = 558 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -3 Query: 287 NVFLNIILLEKRNQTNFRKFHCTILAC 207 NV L++ +LE+ N +F+K C+ L+C Sbjct: 4 NVDLDVCVLERPNVCSFKKRSCSKLSC 30 >At1g04700.1 68414.m00467 protein kinase family protein low similarity to EDR1 [Arabidopsis thaliana] GI:11127925; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 1042 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +3 Query: 417 IVIFLIKITPLTKRPELFQKQRLNLNRIT 503 I +FL+ T ++ P++F ++ +N+NR T Sbjct: 216 IRVFLVPSTESSESPKIFHERNMNINRNT 244 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,390,514 Number of Sequences: 28952 Number of extensions: 230805 Number of successful extensions: 547 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -