BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1009 (528 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81491-17|CAO82030.1| 959|Caenorhabditis elegans Hypothetical p... 29 2.7 Z81092-2|CAB03145.3| 959|Caenorhabditis elegans Hypothetical pr... 29 2.7 Z93384-4|CAE17903.1| 308|Caenorhabditis elegans Hypothetical pr... 27 6.3 AL021492-15|CAE18000.1| 308|Caenorhabditis elegans Hypothetical... 27 6.3 Z83238-8|CAB05799.2| 355|Caenorhabditis elegans Hypothetical pr... 27 8.3 AF077544-5|AAK39240.1| 398|Caenorhabditis elegans Aspartyl prot... 27 8.3 >Z81491-17|CAO82030.1| 959|Caenorhabditis elegans Hypothetical protein F58D12.3 protein. Length = 959 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 339 PIFKTGIILCPY*SDLNTYYINTSLLASI*RSNKNIRSN 455 P+ +T IIL P ++ Y + +SL+ SN NIRS+ Sbjct: 186 PMVRTKIILTPDSTEFMDYNVLSSLIIGRCESNSNIRSS 224 >Z81092-2|CAB03145.3| 959|Caenorhabditis elegans Hypothetical protein F58D12.3 protein. Length = 959 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 339 PIFKTGIILCPY*SDLNTYYINTSLLASI*RSNKNIRSN 455 P+ +T IIL P ++ Y + +SL+ SN NIRS+ Sbjct: 186 PMVRTKIILTPDSTEFMDYNVLSSLIIGRCESNSNIRSS 224 >Z93384-4|CAE17903.1| 308|Caenorhabditis elegans Hypothetical protein Y45F10D.15 protein. Length = 308 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 212 KHKKLIFEIITSIRTTIV*LCIFSF 138 KH+ + FE+ T +R T+V +FSF Sbjct: 118 KHRSVSFEVTTRMRRTLVAFNLFSF 142 >AL021492-15|CAE18000.1| 308|Caenorhabditis elegans Hypothetical protein Y45F10D.15 protein. Length = 308 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 212 KHKKLIFEIITSIRTTIV*LCIFSF 138 KH+ + FE+ T +R T+V +FSF Sbjct: 118 KHRSVSFEVTTRMRRTLVAFNLFSF 142 >Z83238-8|CAB05799.2| 355|Caenorhabditis elegans Hypothetical protein T08G3.10 protein. Length = 355 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 197 IFEIITSIRTTI-V*LCIFSFDQSRNGISSIINQN 96 IF+ I +I T+ + LC F Q R + SII +N Sbjct: 309 IFQFINTINATVHLLLCYFMSSQYRRTVRSIIRKN 343 >AF077544-5|AAK39240.1| 398|Caenorhabditis elegans Aspartyl protease protein 3 protein. Length = 398 Score = 27.1 bits (57), Expect = 8.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 192 KNEFFVFWLCRDINE 236 KN+ F FWL RD N+ Sbjct: 209 KNQLFAFWLSRDAND 223 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,731,339 Number of Sequences: 27780 Number of extensions: 236381 Number of successful extensions: 436 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -