BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1009 (528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44820.2 68415.m05579 expressed protein 29 2.6 At2g44820.1 68415.m05578 expressed protein 29 2.6 >At2g44820.2 68415.m05579 expressed protein Length = 194 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 143 SFDQSRNGISSIINQNEG*KNLSKSVA--GICHTHWR 39 S ++ + G+ S I+QN KN+ K VA G H W+ Sbjct: 7 SMEKKKEGMGSTIDQNLSFKNIMKDVALFGSSHMTWK 43 >At2g44820.1 68415.m05578 expressed protein Length = 194 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 143 SFDQSRNGISSIINQNEG*KNLSKSVA--GICHTHWR 39 S ++ + G+ S I+QN KN+ K VA G H W+ Sbjct: 7 SMEKKKEGMGSTIDQNLSFKNIMKDVALFGSSHMTWK 43 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,771,377 Number of Sequences: 28952 Number of extensions: 205824 Number of successful extensions: 298 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -