BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1006 (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 27 0.077 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 24 0.95 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 2.2 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 2.9 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 22 2.9 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 27.5 bits (58), Expect = 0.077 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -3 Query: 319 PSKLVFVCFSVVGTYLCIVLSWMLTKY--SAC*RSSQWGPSPSVRGSVIF 176 P K ++C + +C+ L+W + S +Q+GP V GS++F Sbjct: 175 PLKAGYICTKTRASLICL-LAWFIAALFTSPILAITQYGPEEYVDGSIVF 223 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.8 bits (49), Expect = 0.95 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 361 WSVVPSTGNMKPTLP 317 WS + TGN PTLP Sbjct: 118 WSKLIETGNKPPTLP 132 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 355 VVPSTGNMKPTLPSKLVFVCFSVVGTYLCIVL 260 +V T N T+ ++F+ + +VGT+ I L Sbjct: 234 IVIGTKNTIETVAYSVIFILWHIVGTFSGIFL 265 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 271 TNMYQLLKNIQKPV*MGGLVSYYQWK 348 TN+ Q+++ +Q P + GL + +WK Sbjct: 448 TNL-QVIQWMQNPTELNGLRDFQEWK 472 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 271 TNMYQLLKNIQKPV*MGGLVSYYQWK 348 TN+ Q+++ +Q P + GL + +WK Sbjct: 455 TNL-QVIQWMQNPTELNGLRDFQEWK 479 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,719 Number of Sequences: 336 Number of extensions: 2762 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -