BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1006 (528 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 28 0.75 SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit |... 27 1.3 SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|... 26 3.0 SPBC18A7.02c |||seven transmembrane receptor-like protein|Schizo... 26 3.0 SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non ca... 26 4.0 SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Sc... 25 7.0 SPBP35G2.05c |cki2||serine/threonine protein kinase Cki2|Schizos... 25 7.0 SPCC74.03c |ssp2|ucp9|serine/threonine protein kinase Ssp2|Schiz... 25 7.0 SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosa... 25 9.2 SPBC17D11.02c |||synoviolin homolog|Schizosaccharomyces pombe|ch... 25 9.2 SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit ... 25 9.2 SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pomb... 25 9.2 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 28.3 bits (60), Expect = 0.75 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -3 Query: 421 LPSSPSHCMKRNLRSTPTTNWSVVPSTGNMKPTLPSKL 308 LPS PS R TP T +++P G M P K+ Sbjct: 509 LPSEPSQNQPAEYRDTPDTPRNIMPLPGLMSADQPIKV 546 >SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 661 Score = 27.5 bits (58), Expect = 1.3 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +3 Query: 171 IEKITEPLTLGEGPHWDERQQALYFVSIQDKTIHKYVPTTEKHTKTSLDGRVGFIL 338 I + E G P WDE+++AL F Q K +P T + T R F L Sbjct: 516 ISAVDESAHQGHLPGWDEKEEALIFSLAQGMNPMK-MPLTPRRASTGPRPRPTFQL 570 >SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1184 Score = 26.2 bits (55), Expect = 3.0 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -3 Query: 406 SHCMKRN--LRSTPTTNWSVVPSTGNMKPTLPSKLV 305 SH N + + P N S VP+TGN+K L V Sbjct: 1095 SHAAHSNNVIGTQPHVNVSAVPNTGNLKDALEGSAV 1130 >SPBC18A7.02c |||seven transmembrane receptor-like protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 457 Score = 26.2 bits (55), Expect = 3.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 310 LVFVCFSVVGTYLCIVLSWMLTKYS 236 ++F C V+ L ++LSW T+YS Sbjct: 248 ILFACQLVLDLALLLILSWGYTRYS 272 >SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non catalytic subunit Arm1|Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 25.8 bits (54), Expect = 4.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 238 YTL*ASKIKLYTNMYQLLKNI 300 Y + A+K K +T YQLLKNI Sbjct: 717 YHVSATKKKEFTRQYQLLKNI 737 >SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1458 Score = 25.0 bits (52), Expect = 7.0 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 234 ALYFVSIQDKTIHKYVPTTEKHTKTSLDGRVGFILPVEGTTDQFVV 371 A+ +I+ K + K V + K K SL+ + LP+EGT F V Sbjct: 295 AINLSAIKSKHLQKIVVLSSKG-KVSLESPMSPSLPIEGTFRSFRV 339 >SPBP35G2.05c |cki2||serine/threonine protein kinase Cki2|Schizosaccharomyces pombe|chr 2|||Manual Length = 435 Score = 25.0 bits (52), Expect = 7.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 337 YQWKVQQTNL*WESNASSFSYSGMER 414 Y W + WES++S FS M+R Sbjct: 293 YDWMLLNDGKGWESSSSHFSVVAMKR 318 >SPCC74.03c |ssp2|ucp9|serine/threonine protein kinase Ssp2|Schizosaccharomyces pombe|chr 3|||Manual Length = 576 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 204 EGPHWDERQQALYFVSIQDKTIHKYVPTTEKH 299 EGP W Y D I VPT EK+ Sbjct: 392 EGPRWTVSDPPTYAKQTIDSNICVLVPTAEKN 423 >SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 24.6 bits (51), Expect = 9.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 214 WGPSPSVRGSVIFSILTDIH 155 W PS + G ++F IL D++ Sbjct: 134 WSPSSFLLGKIVFLILVDLN 153 >SPBC17D11.02c |||synoviolin homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 677 Score = 24.6 bits (51), Expect = 9.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 427 TLLPSSPSHCMKRNLRSTPTTNWSVVPSTGN 335 T+LP + + +ST TTN S P+TG+ Sbjct: 441 TMLPIPGTRRIPTYSQSTSTTNPSATPTTGD 471 >SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit Sfc4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1006 Score = 24.6 bits (51), Expect = 9.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 414 DGSKVAVLKELGEVDKDRPNNRIN 485 D + +A K LGE + R N R+N Sbjct: 163 DNNVIAAWKMLGECHRQRGNGRVN 186 >SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pombe|chr 1|||Manual Length = 923 Score = 24.6 bits (51), Expect = 9.2 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 Query: 293 KTYKNQFRWEGWFHITSGRYNRPICSG 373 K K W G F + S YN + SG Sbjct: 48 KFQKENLNWNGLFQLNSISYNSGVVSG 74 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,131,284 Number of Sequences: 5004 Number of extensions: 44665 Number of successful extensions: 110 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -