BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1006 (528 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58332| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_5014| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-07) 30 1.4 SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) 29 3.1 SB_15766| Best HMM Match : Cor1 (HMM E-Value=5.2) 28 5.5 SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) 27 7.2 SB_21785| Best HMM Match : DIX (HMM E-Value=4.4) 27 9.6 SB_8959| Best HMM Match : PAN (HMM E-Value=0.013) 27 9.6 >SB_58332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 159 MSVRIEKITEPLTLGEGPHWDERQQALYFVSIQDKTIH 272 +SV ++ + E L EGPHWDE L ++ K +H Sbjct: 7 VSVLLKNVGE---LCEGPHWDEASGKLVWMDCMQKLVH 41 >SB_5014| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-07) Length = 194 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +2 Query: 293 KTYKNQFRWE----GWFHITSGRYNRPICSGSRTQVPFHT 400 K Y F W G FHI S I + +RT++PFHT Sbjct: 82 KKYYPYFEWPPFCYGLFHILSADVVPEILNHTRTRIPFHT 121 >SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +2 Query: 293 KTYKNQFRWE----GWFHITSGRYNRPICSGSRTQVPFHT 400 K Y F W G FHI S I + +RT++PFHT Sbjct: 932 KKYYPYFEWPPFCYGLFHILSADVVPEILNHTRTRIPFHT 971 >SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) Length = 454 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/86 (20%), Positives = 43/86 (50%), Gaps = 1/86 (1%) Frame = +3 Query: 207 GPHWDERQQALYFVSIQDKTIHKYVPTTEKHTKTSLDGRVGFILPVEGTTDQF-VVGVER 383 GP WD+ ++++ + + + +Y+PT + + L+ R+ + +G ++ VV +E Sbjct: 73 GPDWDKYRESIKSQVTRPRELAEYIPTFNQISDELLE-RLNSLRTPKGRNYEYEVVNLEE 131 Query: 384 KFLFIQWDGEDGSKVAVLKELGEVDK 461 + I+W E + + G ++K Sbjct: 132 E--LIKWSFETATYAMFNQRFGYMEK 155 >SB_15766| Best HMM Match : Cor1 (HMM E-Value=5.2) Length = 249 Score = 27.9 bits (59), Expect = 5.5 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +3 Query: 342 VEGTTDQFVVGVERKFLF--IQWDGEDGSKVAVLKELGEVDKDRPN 473 V+G T V+G E + ++ WDG+ VLK+ GE + R N Sbjct: 47 VQGATLLTVIGEEAQDVYSTFNWDGDINKIEPVLKKFGEYCEPRRN 92 >SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) Length = 1844 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 191 GLRDFFNSHRHPQLNYLKLKY*IY 120 GL DF +SH H L Y L Y +Y Sbjct: 1310 GLLDFLDSHTHGPLPYKGLAYSVY 1333 >SB_21785| Best HMM Match : DIX (HMM E-Value=4.4) Length = 480 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 255 GCSQSIALADVHPSGALPPVL 193 GC + + +ADV PSG LP L Sbjct: 226 GCGKFVFVADVDPSGNLPEFL 246 >SB_8959| Best HMM Match : PAN (HMM E-Value=0.013) Length = 450 Score = 27.1 bits (57), Expect = 9.6 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 195 TLGEGPHWDERQQALYFVSIQDKTIHK 275 T G+G W ++QQ + + D+ IH+ Sbjct: 185 TKGQGNSWKDKQQTKERIEVTDRQIHR 211 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,864,060 Number of Sequences: 59808 Number of extensions: 330750 Number of successful extensions: 665 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 665 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -