BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1005 (552 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 44 0.002 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 35 1.4 UniRef50_Q7N0G3 Cluster: Similarities with ribonuclease; n=1; Ph... 33 3.3 UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 33 5.8 UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subuni... 33 5.8 UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein;... 32 7.7 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 44.0 bits (99), Expect = 0.002 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -1 Query: 492 GKCFR*CSSCDDPRISPLTSQYECPQ 415 GKCFR C S ++ RISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.7 bits (76), Expect = 1.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 76 SWNYRGCWHQTCPPL 32 SWNYR CWHQT P L Sbjct: 7 SWNYRSCWHQTGPLL 21 >UniRef50_Q7N0G3 Cluster: Similarities with ribonuclease; n=1; Photorhabdus luminescens subsp. laumondii|Rep: Similarities with ribonuclease - Photorhabdus luminescens subsp. laumondii Length = 272 Score = 33.5 bits (73), Expect = 3.3 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -3 Query: 196 SPTICSANVSVSPRMRCTDSAAH-KCNYELFNRNNFSIRYWSWNYRGCWHQTC 41 SP C R++ ++ A + YE F FS +SW G W QTC Sbjct: 92 SPAFCKGKAKNIERLKKSNKLAEAQREYEKFELQCFSENKFSWVIHGLWAQTC 144 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 32.7 bits (71), Expect = 5.8 Identities = 20/47 (42%), Positives = 23/47 (48%) Frame = -1 Query: 150 GAPTARRTNVTTSFLTATILVYXXXXXXXXXXXTRLALHCSSLKYLK 10 G P AR + TTSFLTA L+Y TRLAL +K K Sbjct: 30 GGPPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFK 76 >UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subunit p20; n=1; Polaromonas naphthalenivorans CJ2|Rep: Peptidase C14, caspase catalytic subunit p20 - Polaromonas naphthalenivorans (strain CJ2) Length = 562 Score = 32.7 bits (71), Expect = 5.8 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 172 VSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWS 74 V+ PR+R D AA + NY L NR+N+ + W+ Sbjct: 163 VNAPPRVRAADPAAVQANY-LANRSNYEVSQWT 194 >UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 389 Score = 32.3 bits (70), Expect = 7.7 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -3 Query: 481 SLMFVLRRSKNFTSNVAIRMPPVIPINHYLG 389 S+M V+ RS FT IR+PP+ I+H+LG Sbjct: 20 SVMGVVERSAVFTRQRDIRLPPIPGISHHLG 50 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,258,414 Number of Sequences: 1657284 Number of extensions: 9349116 Number of successful extensions: 20404 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20401 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 36238783989 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -