BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1005 (552 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 28 0.047 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 4.1 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 7.2 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 21 9.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 28.3 bits (60), Expect = 0.047 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 103 RNNFSIRYWSWNYRGCWHQTC 41 R+NF + WNY CW C Sbjct: 746 RHNFKGLHLDWNYPVCWQSNC 766 Score = 23.4 bits (48), Expect = 1.3 Identities = 8/25 (32%), Positives = 9/25 (36%) Frame = -3 Query: 115 ELFNRNNFSIRYWSWNYRGCWHQTC 41 + NNF W Y CW C Sbjct: 1930 DFIETNNFDGLDLDWEYPKCWQVDC 1954 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/19 (36%), Positives = 7/19 (36%) Frame = -3 Query: 97 NFSIRYWSWNYRGCWHQTC 41 NF W Y CW C Sbjct: 1511 NFDGLDLDWEYPKCWQVDC 1529 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 112 LFNRNNFSIRYW 77 +F NFSI YW Sbjct: 1615 VFYNANFSINYW 1626 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/19 (36%), Positives = 7/19 (36%) Frame = -3 Query: 97 NFSIRYWSWNYRGCWHQTC 41 NF W Y CW C Sbjct: 2434 NFDGLDLDWEYPKCWQVDC 2452 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.8 bits (44), Expect = 4.1 Identities = 5/16 (31%), Positives = 9/16 (56%) Frame = -3 Query: 94 FSIRYWSWNYRGCWHQ 47 +++ YW Y WH+ Sbjct: 117 YAVYYWRQQYEDFWHR 132 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.0 bits (42), Expect = 7.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 283 FEQIRVLKAG*KCCLNISCME**NMISVLFC 375 F+QI V+ + K LN C E + + FC Sbjct: 223 FDQIVVILSKVKSILNKKCCEKCGLKKIEFC 253 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 20.6 bits (41), Expect = 9.5 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = -1 Query: 204 TPAHRRYAPQTCQYHRGCGAPTARRTNVTTSFLTATI 94 T + Y P Y G G A R T TAT+ Sbjct: 63 TTGYYPYDPALAAYGYGAGYDLAARRKNATRESTATL 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,854 Number of Sequences: 336 Number of extensions: 2423 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -