BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1005 (552 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97000-11|AAC47993.1| 321|Caenorhabditis elegans Serpentine rec... 28 3.9 AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical ... 28 5.1 U39999-6|AAA81107.2| 198|Caenorhabditis elegans Hypothetical pr... 27 6.8 Z81143-5|CAB03518.2| 370|Caenorhabditis elegans Hypothetical pr... 27 9.0 AC006675-6|AAK84556.2| 433|Caenorhabditis elegans Nuclear hormo... 27 9.0 >U97000-11|AAC47993.1| 321|Caenorhabditis elegans Serpentine receptor, class g (gamma)protein 33 protein. Length = 321 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 112 LFNRNNFSIRYWSWNYRGCWHQTCP-PLFLVKIFKVP 5 L + N FS+ +WS Y W++ P + LV + VP Sbjct: 109 LTSLNRFSMIFWSATYEKAWNRAFPFVIILVIVLPVP 145 >AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical protein H41C03.3 protein. Length = 506 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = -3 Query: 184 CSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 65 C NV + P DSA H N +N I WNY Sbjct: 211 CLPNVLLLPDEESVDSAGHNINLAHYNCLRVLINKPGWNY 250 >U39999-6|AAA81107.2| 198|Caenorhabditis elegans Hypothetical protein F41G3.10 protein. Length = 198 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 192 RRYAPQTCQYHRGCGAPTARRTNVTTSFL 106 R+ P+TC Y G G T RT+ T + L Sbjct: 130 RQQCPRTCGYCSGSGVVTTTRTSTTCADL 158 >Z81143-5|CAB03518.2| 370|Caenorhabditis elegans Hypothetical protein ZK265.7 protein. Length = 370 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 251 EEHRDRILILNRRFLERRLTDDMLRKRV 168 EE R+R + RR ERRL +D + +R+ Sbjct: 294 EEERERYRMERRRAEERRLQEDTILRRI 321 >AC006675-6|AAK84556.2| 433|Caenorhabditis elegans Nuclear hormone receptor familyprotein 98 protein. Length = 433 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 453 LDRRKTNISESICQRCFHQSRTKVRGS 533 L+ +S ICQ CFHQ K++G+ Sbjct: 331 LEPTHEELSYMICQLCFHQVGKKLQGN 357 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,812,987 Number of Sequences: 27780 Number of extensions: 236749 Number of successful extensions: 485 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -