BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1005 (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49060.1 68416.m05360 protein kinase family protein / U-box d... 27 6.3 At5g38320.1 68418.m04625 expressed protein ; expression support... 27 8.3 At2g36350.1 68415.m04461 protein kinase, putative similar to pro... 27 8.3 >At3g49060.1 68416.m05360 protein kinase family protein / U-box domain-containing protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 805 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -3 Query: 499 HLWQMLSLMFVLRRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIE 365 H+W + + R+ N SN MPP++ ++ K+ K+E Sbjct: 162 HIWFLCKGYLIFTRASNDDSNNRQTMPPLVQLDSDNETRKSEKLE 206 >At5g38320.1 68418.m04625 expressed protein ; expression supported by MPSS Length = 212 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 460 RSKNFTSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSI-IPCTKYSSS 320 RSK + P +IPI + VL+ +I + Y + +P Y+S+ Sbjct: 85 RSKTDKYKTGLPRPEIIPIEDFEPVLEIEEIGDQEYEVKLPLLPYNST 132 >At2g36350.1 68415.m04461 protein kinase, putative similar to protein kinase KIPK (KCBP-interacting protein kinase) [Arabidopsis thaliana] gi|7716430|gb|AAF68383 Length = 949 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 311 PALSTLICSK*NCRPTSTLTEEH 243 P+ S L+C K +C ST TE H Sbjct: 391 PSASQLLCQKCHCAVKSTSTENH 413 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,829,171 Number of Sequences: 28952 Number of extensions: 206898 Number of successful extensions: 434 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -