BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1004 (546 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0200 - 6360682-6362517,6362599-6362670 28 4.2 05_02_0139 + 7041030-7041188,7041451-7042215,7044133-7044519 28 5.6 >03_02_0200 - 6360682-6362517,6362599-6362670 Length = 635 Score = 28.3 bits (60), Expect = 4.2 Identities = 6/29 (20%), Positives = 21/29 (72%) Frame = -2 Query: 272 IKLFSVRLMPFVRSYFFSGDLMKILTTIE 186 ++ F + + ++ YF +GD++++++++E Sbjct: 340 VRQFKAKTLSIIKEYFLTGDIIEVMSSLE 368 >05_02_0139 + 7041030-7041188,7041451-7042215,7044133-7044519 Length = 436 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -2 Query: 254 RLMPFVRSYFFSGDLMKILTTIECVVFKNRMAIL-HFRDSGNRK 126 R++P+ + + D+ +I+ IE F+N MA L R+S N K Sbjct: 209 RVLPYKKGEYSGKDMDRIMRPIELEEFRNAMAALGGSRNSANLK 252 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,733,806 Number of Sequences: 37544 Number of extensions: 205841 Number of successful extensions: 328 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -