BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1004 (546 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.6 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 6.6 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 8.7 AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synth... 23 8.7 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 365 QFTYEDFKLKTQIYLSLNGMIDVKLMSTHFNTIRAQ 472 Q+TYED ++YL+ G + L+ N + A+ Sbjct: 3292 QWTYEDLAEDVEVYLN-KGQGSMNLLDERINALEAE 3326 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -3 Query: 511 TTTHPDYTSNHTPLGSYCI 455 T HP+ T G YCI Sbjct: 395 TANHPNATCGRPEFGDYCI 413 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 22.6 bits (46), Expect = 8.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 529 EKNQGLTTTHPDYTSNHTPLGSYCIKVS 446 E + LTTTH +G YC+ S Sbjct: 151 ETSSILTTTHTSVPKMCAKIGEYCLTSS 178 >AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synthase protein. Length = 142 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 366 CNTENVKFYKSINKSICATKNLDRVY 289 C T+NV Y+ + + LDRV+ Sbjct: 31 CRTKNVDLYRDEKEEMVQKGVLDRVF 56 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 514,039 Number of Sequences: 2352 Number of extensions: 9597 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -