BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1004 (546 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43300.1 68418.m05292 glycerophosphoryl diester phosphodieste... 28 3.5 At1g53180.1 68414.m06027 expressed protein 27 6.2 >At5g43300.1 68418.m05292 glycerophosphoryl diester phosphodiesterase family protein contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 333 Score = 28.3 bits (60), Expect = 3.5 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = +1 Query: 151 CSIAILFLNTTHSIVVNIFIRSPEKKYDLTKGIRRTLNNL--IMHKFKINAI*IFGSTNR 324 C++ FLN HS+ NI ++ + +R+TL+N+ ++++ N IF S + Sbjct: 117 CTLEDAFLNVKHSLGFNIELKFDDNTVYGEGELRQTLDNILTVVNEHSKNRPIIFSSFHP 176 Query: 325 FIYRFIKFNILCIAIY 372 R I+ C ++ Sbjct: 177 DAARLIRNMQRCYPVF 192 >At1g53180.1 68414.m06027 expressed protein Length = 358 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 534 SWKKIKVSLQRTQTIP 487 S+ +K+SLQRTQT+P Sbjct: 209 SYSSVKISLQRTQTMP 224 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,252,514 Number of Sequences: 28952 Number of extensions: 188799 Number of successful extensions: 387 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -