BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1003 (344 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 3.2 AF457557-1|AAL68787.1| 90|Anopheles gambiae hypothetical prote... 23 3.2 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 22 7.4 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 21 9.7 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 244 EDLYAGKTTKLQLSKNVICAHCTGVG 321 +D YA + T++ L + C C G+G Sbjct: 674 QDFYANEETRICLPCHQECRGCHGLG 699 >AF457557-1|AAL68787.1| 90|Anopheles gambiae hypothetical protein 10 protein. Length = 90 Score = 23.0 bits (47), Expect = 3.2 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +2 Query: 125 MKFLVIALVTSLEWVGVEDVVKAVVQSVAKIPC 223 M+FL + V L WVGV V A I C Sbjct: 1 MRFLSVLTVGLLVWVGVFATVNAEDPRTELIGC 33 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 211 RHGLDHGLDHILYSHPFQRGYQSNYQKFHQP 119 RH + HG + S + YQ K H+P Sbjct: 39 RHSIRHGRNGDKRSRMIKELYQQTEPKSHRP 69 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +3 Query: 192 PWSSPWRRYHASPCSDIRRFVCWENYKIAAQQKRNLCPLYRCG 320 P ++ W+R HA R Y A +++R + L + G Sbjct: 231 PAAAGWQRQHAKQTEYQCRLTYVLEYVSAPKRRREMMTLIKLG 273 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 339,037 Number of Sequences: 2352 Number of extensions: 6079 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24505155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -