BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1001 (582 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0066 - 652339-652382,652641-653593,654492-654568,655812-65... 31 0.51 >04_01_0066 - 652339-652382,652641-653593,654492-654568,655812-655917, 656200-656261,656676-656784,657015-657385 Length = 573 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 159 LVPRKNTRLTYLNVQSFIQTILL-FIKIVNN*CFNYFPLKI 278 +V TRLTY ++ F+ IL+ F+ ++ F +FPLKI Sbjct: 201 IVVTSRTRLTYFRMERFLPKILIFFLPFISVKEFPWFPLKI 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,195,590 Number of Sequences: 37544 Number of extensions: 260279 Number of successful extensions: 468 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -