BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1000 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0389 - 13409848-13409964,13410049-13410114,13410209-134103... 31 0.99 03_05_1156 - 30814037-30814190,30814277-30815166 30 1.3 08_01_1043 + 10565632-10565676,10565755-10565826,10566186-105662... 28 5.3 01_01_0423 + 3198075-3199010 28 5.3 09_04_0020 + 13837257-13837281,13837364-13837550,13837655-138377... 28 7.0 01_05_0787 - 25215911-25216041,25216308-25216366,25218239-252183... 27 9.2 >05_03_0389 - 13409848-13409964,13410049-13410114,13410209-13410325, 13410822-13410893,13410979-13411258,13411528-13411730, 13412230-13412316,13412705-13412758,13413042-13413221, 13414402-13414576,13414628-13414918,13414923-13415344 Length = 687 Score = 30.7 bits (66), Expect = 0.99 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 461 STEDEFYTICLNLTAEDPSFGNCNYTTDFENG 556 S+ EFY +C N+ P G ++T+F NG Sbjct: 129 SSFQEFYNVCRNICLSSPWDGQLAHSTEFYNG 160 >03_05_1156 - 30814037-30814190,30814277-30815166 Length = 347 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 359 REKQEGTIEYQFWTNL*PSVVKFSNETLISFKME--STEDEFYTICLNLT 502 R + I+Y+F+TN V+ + T+ +K+E S D FY +C +T Sbjct: 174 RAIETNRIKYKFYTNALLLVLSIISGTVFLWKVEKLSLVDSFYCVCATIT 223 >08_01_1043 + 10565632-10565676,10565755-10565826,10566186-10566289, 10566482-10566574,10571044-10571183,10571297-10571427 Length = 194 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 257 FTSRYKDVSCKRGSSA*TRIKKFTT*LTVNKTQ 159 FTSRYK++ K SS+ + KF LT + Q Sbjct: 119 FTSRYKEILSKSHSSSMMTVPKFVPRLTKEEAQ 151 >01_01_0423 + 3198075-3199010 Length = 311 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = +2 Query: 341 TRLRCPREKQEGTIEYQFWTNL*PSVVKFSNETLISFKMESTEDEFYTICLNLT 502 T + R GT++ +++T L + F NET + + E + + Y + LT Sbjct: 74 TYFKASRNNLSGTLKEEWFTRLKSMITDFGNETSV-MEYEGDQKQIYQVTTVLT 126 >09_04_0020 + 13837257-13837281,13837364-13837550,13837655-13837727, 13837769-13837804,13838161-13838281,13838399-13838472, 13838594-13838730,13839262-13839325,13839693-13839758, 13840061-13840130,13840206-13840310,13840840-13840981, 13841343-13841439,13841939-13842460 Length = 572 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 446 SFKMESTEDEFYTICLNLTAEDPSFGNCNYTTDFENGELLEKVVSRVV 589 + K+ +TE + C++ T DP N N+ D G E V V+ Sbjct: 467 NLKINATEKFIVSFCMDETENDPQKQNLNFGGDMPQGCRTEGVAEGVL 514 >01_05_0787 - 25215911-25216041,25216308-25216366,25218239-25218336, 25218521-25218831,25219298-25219402,25219831-25219886, 25220029-25220105 Length = 278 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +1 Query: 250 DVNKLGSGVQGKNRMGLLNISSGQ---ICNQV*N 342 DV++LG + K GL N+SS +CNQV N Sbjct: 189 DVHRLGEYAESKMDEGLANLSSATDRCLCNQVKN 222 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,326,327 Number of Sequences: 37544 Number of extensions: 296584 Number of successful extensions: 675 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -