BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1000 (626 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 25 2.6 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 7.9 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 378 VPSCFSLGHRSRVSHLVTNLSRTDIQ*SHP 289 VP+ F LG+ SHL+ +L R +++ HP Sbjct: 38 VPARFPLGNIQHASHLMLDLYR-ELKGKHP 66 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 351 RSRVSHLVTNLSRTDIQ*SHPVFPLDTG 268 RSRVS ++ +L+ D+ + + PL+ G Sbjct: 109 RSRVSLMICHLAVADLMVAFIMIPLEVG 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,089 Number of Sequences: 2352 Number of extensions: 11622 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -