BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0999 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32385| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_30386| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) 45 5e-05 SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) 41 9e-04 SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) 38 0.005 SB_43219| Best HMM Match : zf-CCHC (HMM E-Value=0.0056) 38 0.006 SB_21302| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-27) 38 0.006 SB_54145| Best HMM Match : zf-CCHC (HMM E-Value=0.021) 38 0.008 SB_21351| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) 38 0.008 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.044 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.059 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.078 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.078 SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 34 0.10 SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 34 0.10 SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_51966| Best HMM Match : zf-CCHC (HMM E-Value=0.00038) 33 0.18 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.18 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 33 0.18 SB_42797| Best HMM Match : Peptidase_A16_N (HMM E-Value=2e-05) 33 0.18 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) 33 0.18 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_46068| Best HMM Match : zf-CCHC (HMM E-Value=0.0034) 33 0.24 SB_35429| Best HMM Match : Laminin_EGF (HMM E-Value=5.3e-17) 33 0.24 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_56362| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 32 0.31 SB_53919| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 32 0.31 SB_48157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 32 0.31 SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 32 0.31 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_155| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 32 0.31 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_31343| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 32 0.31 SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 32 0.31 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) 32 0.31 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51937| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 32 0.41 SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) 32 0.41 SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) 32 0.41 SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38) 32 0.41 SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) 32 0.41 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 32 0.41 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46071| Best HMM Match : RVP (HMM E-Value=3e-05) 32 0.41 SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) 32 0.41 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_23675| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 32 0.41 SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) 32 0.41 SB_19158| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) 32 0.41 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_15324| Best HMM Match : RVP (HMM E-Value=8.1e-05) 32 0.41 SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) 32 0.41 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 31 0.55 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 31 0.55 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_13669| Best HMM Match : zf-CCHC (HMM E-Value=1.3e-06) 31 0.72 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) 31 0.72 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 30 1.3 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_16910| Best HMM Match : EGF (HMM E-Value=0) 30 1.3 SB_13566| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 30 1.3 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 30 1.3 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_22648| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 30 1.3 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 30 1.7 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) 30 1.7 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) 30 1.7 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 30 1.7 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 30 1.7 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 30 1.7 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 30 1.7 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 30 1.7 SB_9510| Best HMM Match : Keratin_B2 (HMM E-Value=3.8e-05) 30 1.7 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 30 1.7 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 30 1.7 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_55492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 30 1.7 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 30 1.7 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 30 1.7 SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) 30 1.7 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 29 2.2 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_10083| Best HMM Match : Ion_trans (HMM E-Value=0) 29 2.2 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 2.9 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_47175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15) 29 2.9 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_22124| Best HMM Match : Ion_trans_2 (HMM E-Value=1.6e-14) 29 2.9 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 29 2.9 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 29 2.9 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_6211| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) 29 2.9 SB_51991| Best HMM Match : UPF0185 (HMM E-Value=3.3e-14) 29 2.9 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_37538| Best HMM Match : zf-CCHC (HMM E-Value=0.0011) 29 2.9 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_23731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 29 2.9 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 29 2.9 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_40812| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 29 3.9 SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 29 3.9 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_26948| Best HMM Match : LIM (HMM E-Value=2.3e-39) 29 3.9 SB_25423| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 29 3.9 SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) 29 3.9 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 29 3.9 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 3.9 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 29 3.9 SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23806| Best HMM Match : zf-CCHC (HMM E-Value=0.0069) 29 3.9 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 28 5.1 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 28 5.1 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 5.1 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_27878| Best HMM Match : zf-CCHC (HMM E-Value=0.00046) 28 5.1 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_20467| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.1 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 28 5.1 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 28 5.1 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) 28 5.1 SB_48269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 28 5.1 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 28 5.1 SB_35592| Best HMM Match : zf-CCHC (HMM E-Value=0.0087) 28 5.1 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) 28 5.1 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_18690| Best HMM Match : zf-CCHC (HMM E-Value=0.0035) 28 5.1 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 28 5.1 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_11742| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 28 5.1 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 28 5.1 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 28 5.1 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_59611| Best HMM Match : zf-CCHC (HMM E-Value=7.7e-05) 28 6.7 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 28 6.7 SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) 28 6.7 SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28) 28 6.7 SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30) 28 6.7 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_50862| Best HMM Match : zf-C2H2 (HMM E-Value=3) 28 6.7 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 28 6.7 SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32) 28 6.7 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 28 6.7 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 28 6.7 SB_27928| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_24593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_23509| Best HMM Match : XET_C (HMM E-Value=3.6) 28 6.7 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_21600| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 28 6.7 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 28 6.7 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 28 6.7 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 28 6.7 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_43550| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 6.7 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 28 6.7 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_24581| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 28 6.7 SB_21743| Best HMM Match : rve (HMM E-Value=4e-17) 28 6.7 SB_19905| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 28 6.7 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 28 6.7 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 28 6.7 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 28 6.7 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_4864| Best HMM Match : zf-CCHC (HMM E-Value=6.9e-07) 28 6.7 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_45717| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 27 8.9 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 27 8.9 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1) 27 8.9 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 27 8.9 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) 27 8.9 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 27 8.9 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 27 8.9 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 27 8.9 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_1235| Best HMM Match : Astacin (HMM E-Value=0.0024) 27 8.9 SB_1082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 27 8.9 >SB_32385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1322 Score = 44.8 bits (101), Expect = 5e-05 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = -2 Query: 305 VQCFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSC 183 ++CFNC GHTR C RC CGG H C TF+C Sbjct: 526 LRCFNCSESGHTRAACYMDQRCMLCGGSHEVDDC---TFNC 563 >SB_30386| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) Length = 90 Score = 44.8 bits (101), Expect = 5e-05 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = -2 Query: 305 VQCFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSC 183 ++CFNC GHTR C RC CGG H C TF+C Sbjct: 18 LRCFNCSESGHTRAACYMDQRCMLCGGSHEVDDC---TFNC 55 >SB_54032| Best HMM Match : Peptidase_A17 (HMM E-Value=5.20022e-42) Length = 832 Score = 40.7 bits (91), Expect = 9e-04 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTE 195 C+NC H +C SK RC +CGG+H C + Sbjct: 103 CYNCLSSSHISSKCTSKFRCRQCGGKHHTTICERD 137 >SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) Length = 1461 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVN 177 CFNC + H +C+SK C KC H C+++ S N Sbjct: 286 CFNCTKGKHRAEECKSKSNCFKCKQRHDTSICDSDVKSNSN 326 >SB_43219| Best HMM Match : zf-CCHC (HMM E-Value=0.0056) Length = 693 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVN 177 CFNC + H +C+SK C KC H C+++ S N Sbjct: 263 CFNCTKGKHRAEECKSKSNCFKCKQRHHTSICDSDVKSNSN 303 >SB_21302| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-27) Length = 1290 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVN 177 CFNC + H +C+SK C KC H C+++ S N Sbjct: 328 CFNCTKRKHRAEECKSKSNCFKCKQRHHTSICDSDVKSNSN 368 >SB_54145| Best HMM Match : zf-CCHC (HMM E-Value=0.021) Length = 286 Score = 37.5 bits (83), Expect = 0.008 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVN 177 CFNC + H +C+SK C KC H C+++ S N Sbjct: 23 CFNCTKGKHHAEECKSKSNCFKCKRRHHTSICDSDVKSNSN 63 >SB_21351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 37.5 bits (83), Expect = 0.008 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTE 195 C+NC H +C SK RC +C G+H C + Sbjct: 416 CYNCLSSSHISSKCTSKFRCRQCRGKHHTTICERD 450 >SB_16017| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-19) Length = 879 Score = 37.5 bits (83), Expect = 0.008 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTE 195 C+NC H +C SK RC +CGG+ C + Sbjct: 215 CYNCLSSSHISSKCTSKFRCRQCGGKRHTTICERD 249 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS A + L+ NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIAPRFPLFLISNSCSPGDPLVLERPPP 39 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 36.7 bits (81), Expect = 0.015 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 15/62 (24%) Frame = -2 Query: 314 YPTVQCFNCCRFGHTRVQCRS------------KPR--CNKCG-GEHSGLACNTETFSCV 180 Y +C NC + GH + C+S KP+ C++CG EH G +C + + C Sbjct: 512 YKKYKCDNCGKVGHLKRVCQSKECKKXXXXQGGKPKTACHRCGSAEHDGKSCKYKKYKCD 571 Query: 179 NC 174 NC Sbjct: 572 NC 573 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 492 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 520 >SB_27574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 35.5 bits (78), Expect = 0.034 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVN 177 CFNC + + +C+SK C KC H C+++ S N Sbjct: 246 CFNCTKGKYRAEECKSKSNCFKCKQRHHTSICDSDVKSNSN 286 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.1 bits (77), Expect = 0.044 Identities = 21/38 (55%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS S L PI NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANILSYL-PINESNSCSPGDPLVLERPPP 38 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.059 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -2 Query: 140 PEFSRQTNIKKHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 PE S Q N +K Q L + + + + NSCSPGDPL R PP Sbjct: 4 PELSSQLNQEKEEIQRLEAEKSSWLARGVHASNSCSPGDPLVLERPPP 51 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.7 bits (76), Expect = 0.059 Identities = 22/43 (51%), Positives = 24/43 (55%), Gaps = 7/43 (16%) Frame = -2 Query: 110 KHMSQNLISYQE-----ASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS A K P+LV NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIRISVLALKSRPMLVSNSCSPGDPLVLERPPP 44 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.078 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS KL ++ NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS-ANIPKLKLLITSNSCSPGDPLVLERPPP 38 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 34.3 bits (75), Expect = 0.078 Identities = 15/22 (68%), Positives = 16/22 (72%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 FP L+ NSCSPGDPL R PP Sbjct: 67 FPCLISNSCSPGDPLVLERPPP 88 >SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1400 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVNCRGEHMATNKSCPEFSRQT 120 C+NC H +C SK RC +CG H + + F + G ++ N PE + T Sbjct: 416 CYNCLSSSHISFKCTSKFRCRQCGA-HQEDEFDLQQFWSLESMG--ISPNADPPEKNFLT 472 Query: 119 N 117 N Sbjct: 473 N 473 >SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1378 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVNCRGEHMATNKSCPEFSRQT 120 C+NC H +C SK RC +CG H + + F + G ++ N PE + T Sbjct: 395 CYNCLSSSHISFKCTSKFRCRQCGA-HQEDEFDLQQFWSLESMG--ISPNADPPEKNFLT 451 Query: 119 N 117 N Sbjct: 452 N 452 >SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1577 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 302 QCFNCCRFGHTRVQCRSK-PRCNKCGGEHSGLACNTE 195 +CF C R H +C+SK C C G H C + Sbjct: 357 RCFRCLRKNHRSYECKSKDSNCKGCAGAHHLSICENQ 393 >SB_51966| Best HMM Match : zf-CCHC (HMM E-Value=0.00038) Length = 447 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 302 QCFNCCRFGHTRVQCRSKPRCNKCGGEHSGLAC 204 +CF C + GH +C +K C+ C G H C Sbjct: 81 RCFICLKKGHRSNECFNKDGCSDCRGRHHVSIC 113 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 33.1 bits (72), Expect = 0.18 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 10/53 (18%) Frame = -2 Query: 131 SRQTNIKKHMSQNLISYQ-EASKL-------FPILVPNSCSPGDPLF--RAPP 3 +R + H++Q+L+ ++ ASKL P + NSCSPGDPL R PP Sbjct: 127 ARLRQVASHLAQHLLQHRLSASKLPQHRVSALPPHLSNSCSPGDPLVLERPPP 179 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 FP++ NSCSPGDPL R PP Sbjct: 888 FPLVTSNSCSPGDPLVLERPPP 909 >SB_42797| Best HMM Match : Peptidase_A16_N (HMM E-Value=2e-05) Length = 668 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 302 QCFNCCRFGHTRVQCRSKPRCNKCGGEHSGLAC 204 +CF C + GH +C +K C+ C G H C Sbjct: 357 RCFICLKKGHRSNECFNKDGCSDCRGRHHVSIC 389 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 5 AAL*IVDPPGCRNSARG*ETI 67 AAL +VDPPGCRNS R TI Sbjct: 11 AALELVDPPGCRNSIRSTTTI 31 >SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) Length = 1692 Score = 33.1 bits (72), Expect = 0.18 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 4/75 (5%) Frame = -2 Query: 356 VYSFFSSIPVEQYIYPTVQCFNCCRFGHTRVQCRSKPRCNKC-GGEHSGLACNT--ETFS 186 +Y + V + + ++CF H R +C S C+KC G+H L C ET Sbjct: 661 IYGKGGKLDVLKQVNARLKCFG----DHLRSKCPSTRLCSKCQSGDHHVLLCKAQKETQG 716 Query: 185 CVNCRGE-HMATNKS 144 +GE H++TNK+ Sbjct: 717 ESYAQGEIHISTNKT 731 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 Query: 5 AAL*IVDPPGCRNSARG*ETI 67 AAL +VDPPGCRNS G T+ Sbjct: 87 AALELVDPPGCRNSIAGKNTV 107 >SB_46068| Best HMM Match : zf-CCHC (HMM E-Value=0.0034) Length = 193 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -2 Query: 326 EQYIYPTVQCFNCC--RFGHTRVQCRSKPRCNKCGGEH 219 +QY CFNC + GH C P C KC G H Sbjct: 92 KQYAIAYGYCFNCGLEKPGHGSSSCPDLPACTKCPGRH 129 >SB_35429| Best HMM Match : Laminin_EGF (HMM E-Value=5.3e-17) Length = 218 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -2 Query: 287 CRFGHTRVQCRSK-PRCNKCGGEHSGLACNTETFSCVNCRGEHMATNKSC 141 C G+TRV+ +C +C L C+ ET C+NC +H C Sbjct: 2 CAPGYTRVKPGPGFSKCTRCKCNRHSLECDPETGKCINC--DHNTAGDRC 49 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS + + I NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIQAIVQVIYPSNSCSPGDPLVLERPPP 39 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.24 Identities = 20/38 (52%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS S F V NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIISIAF---VSNSCSPGDPLVLERPPP 36 >SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -2 Query: 95 NLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 NL+ Y+ + + + NSCSPGDPL R PP Sbjct: 16 NLLGYKSSKRQGGVTGSNSCSPGDPLVLERPPP 48 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 131 SRQTNIKKHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 ++ +N + + L+ E K++P V NSCSPGDPL R PP Sbjct: 5 TKSSNDPRELYLGLLYPTEDYKVYP--VSNSCSPGDPLVLERPPP 47 >SB_56362| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 468 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACN 201 CFNC R GH +C + C KC H C+ Sbjct: 112 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 143 >SB_53919| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 289 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACN 201 CFNC R GH +C + C KC H C+ Sbjct: 175 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 206 >SB_48157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1306 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACN 201 CFNC R GH +C + C KC H C+ Sbjct: 337 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 368 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -2 Query: 71 SKLFPILVPNSCSPGDPLF--RAPP 3 S+ PI + NSCSPGDPL R PP Sbjct: 2 SQSSPITISNSCSPGDPLVLERPPP 26 >SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) Length = 1626 Score = 32.3 bits (70), Expect = 0.31 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACN 201 C+NC + GH +C++ C KC H C+ Sbjct: 305 CYNCTKGGHMATKCKA-GNCAKCNSRHHTSICD 336 >SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 794 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNCRGEHMATNKSCPEFSRQTNIKKHMSQNLISY 81 + K C++CG EH G +C + + C NC G+ + C S++ K++ ++ + Sbjct: 341 KPKTACHRCGSAEHDGKSCKYKKYKCDNC-GKVGHLKRVCQ--SKECKETKYVEVSVDNN 397 Query: 80 QEASKL 63 QE L Sbjct: 398 QEDESL 403 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.31 Identities = 19/38 (50%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS S + P NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIVSYIGP--PSNSCSPGDPLVLERPPP 37 >SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNCRGEHMATNKSCPEFSRQTNIKKHMSQNLISY 81 + K C++CG EH G +C + + C NC G+ + C S++ K++ ++ + Sbjct: 421 KPKTACHRCGSAEHDGKSCKYKKYKCDNC-GKMGHLKRVCQ--SKECKETKYVEVSVDND 477 Query: 80 QEASKL 63 QE L Sbjct: 478 QEDESL 483 >SB_155| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 296 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC----RGEHMATNKSCPEFSRQ 123 + K C++CG EH G +C + + C NC + + +K C E Q Sbjct: 206 KPKTACHRCGSAEHDGKSCKYKKYKCDNCGKVGHLKRVCQSKECKETKMQ 255 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS + F + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANITGE-FQWQISNSCSPGDPLVLERPPP 38 >SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -2 Query: 326 EQYIYPTVQCFNCCRFGHTR--VQCRSKPR-CNKCGGE-HSGLACNTE 195 ++ I + C+ C GHT+ +C + + C KCGG+ H AC T+ Sbjct: 269 DRTIQEDIVCYQCGNVGHTKRDSKCPAHGQTCRKCGGKNHFAKACQTK 316 >SB_33873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1362 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 302 QCFNCCRFGHTRVQCRSK-PRCNKCGGEHSGLACNTE 195 +CF C R + +CRSK C C G H C + Sbjct: 370 RCFRCLRKNYRSYECRSKDSNCKGCAGAHHLSICENQ 406 >SB_31343| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 449 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACN 201 CFNC R GH +C + C KC H C+ Sbjct: 112 CFNCGRTGHRENKCNGR-GCYKCKARHHTSLCH 143 >SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 1750 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNCRGEHMATNKSCPEFSRQTNIKKHMSQNLISY 81 + K C++CG EH G +C + + C NC G+ + C S++ K++ ++ + Sbjct: 184 KPKTACHRCGSAEHDGKSCKYKKYKCDNC-GKVGHLKRVCQ--SKECKETKYVEVSVDNN 240 Query: 80 QEASKL 63 QE L Sbjct: 241 QEDESL 246 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.31 Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS A+ +F L+ NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS---ANIVF--LISNSCSPGDPLVLERPPP 34 >SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33) Length = 1485 Score = 32.3 bits (70), Expect = 0.31 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACN 201 C+NC + GH +C++ C KC H C+ Sbjct: 199 CYNCTKGGHMATKCKA-GNCAKCNSRHHTSICD 230 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -2 Query: 101 SQNLISYQEA-SKLFPILVPNSCSPGDPLF--RAPP 3 S L +Y +K I++ NSCSPGDPL R PP Sbjct: 8 SHRLTNYSNCLNKCHNIVISNSCSPGDPLVLERPPP 43 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 31.9 bits (69), Expect = 0.41 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -2 Query: 128 RQTNIKKHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 ++ + + + LIS+++ +K + + NSCSPGDPL R PP Sbjct: 77 KENTFQYNSREVLISHRQTNK--SLKISNSCSPGDPLVLERPPP 118 >SB_51937| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 151 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 104 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 132 >SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) Length = 1311 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 104 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 132 >SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) Length = 1510 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 206 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 234 >SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38) Length = 856 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 349 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 377 >SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) Length = 1425 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 875 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 903 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 31.9 bits (69), Expect = 0.41 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -2 Query: 116 IKKHMSQNLISYQEASKLFPI--LVPNSCSPGDPLF--RAPP 3 I+ H + + SY + L P+ ++ NSCSPGDPL R PP Sbjct: 32 IRTHPTLSKPSYTITTYLSPLEPILSNSCSPGDPLVLERPPP 73 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.9 bits (69), Expect = 0.41 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 9/45 (20%) Frame = -2 Query: 110 KHMSQNLIS-------YQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS Q ++ L P + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIHCEKIQISNILIPKIASNSCSPGDPLVLERPPP 46 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 31.9 bits (69), Expect = 0.41 Identities = 15/21 (71%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -2 Query: 59 PILVPNSCSPGDPLF--RAPP 3 PIL NSCSPGDPL R PP Sbjct: 63 PILPSNSCSPGDPLVLERPPP 83 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPIL--VPNSCSPGDPLF--RAPP 3 KH + LIS + ++ + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIVFNILEVIHVLSNSCSPGDPLVLERPPP 41 >SB_46071| Best HMM Match : RVP (HMM E-Value=3e-05) Length = 403 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 206 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 234 >SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) Length = 1122 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 222 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 250 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +2 Query: 5 AAL*IVDPPGCRNSARG 55 AAL +VDPPGCRNS G Sbjct: 11 AALELVDPPGCRNSIEG 27 >SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIVRLYYYTFGSNSCSPGDPLVLERPPP 39 >SB_23675| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 342 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 179 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 207 >SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) Length = 238 Score = 31.9 bits (69), Expect = 0.41 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRC 240 CF+C + GH + +CRSK +C Sbjct: 19 CFSCLKRGHPQRECRSKKKC 38 >SB_19158| Best HMM Match : zf-CCHC (HMM E-Value=0.00067) Length = 369 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 206 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 234 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -2 Query: 95 NLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 +L+ S LF I NSCSPGDPL R PP Sbjct: 73 SLVIRSIGSALFIIQTSNSCSPGDPLVLERPPP 105 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_15324| Best HMM Match : RVP (HMM E-Value=8.1e-05) Length = 415 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 43 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 71 >SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) Length = 717 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 257 RSKPRCNKCGG-EHSGLACNTETFSCVNC 174 + K C++CG EH G +C + + C NC Sbjct: 245 KPKTACHRCGSAEHDGKSCKYKKYKCDNC 273 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS R Sbjct: 11 AALELVDPPGCRNSIR 26 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/21 (71%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -2 Query: 59 PILVPNSCSPGDPLF--RAPP 3 P L NSCSPGDPL RAPP Sbjct: 12 PCLRSNSCSPGDPLVLERAPP 32 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/20 (75%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 ILV NSCSPGDPL R PP Sbjct: 8 ILVSNSCSPGDPLVLERPPP 27 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 FP L NSCSPGDPL R PP Sbjct: 63 FPKLSSNSCSPGDPLVLERPPP 84 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +2 Query: 5 AAL*IVDPPGCRNSARG 55 AAL +VDPPGCRNS G Sbjct: 98 AALELVDPPGCRNSITG 114 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.1 bits (67), Expect = 0.72 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 68 KLFPILVPNSCSPGDPLF--RAPP 3 +L L+ NSCSPGDPL R PP Sbjct: 12 ELISFLISNSCSPGDPLVLERPPP 35 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.1 bits (67), Expect = 0.72 Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -2 Query: 80 QEASKLFPILVPNSCSPGDPLF--RAPP 3 Q A +F + NSCSPGDPL R PP Sbjct: 2 QNAFTIFRTISSNSCSPGDPLVLERPPP 29 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.1 bits (67), Expect = 0.72 Identities = 15/23 (65%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -2 Query: 65 LFPILVPNSCSPGDPLF--RAPP 3 LF L+ NSCSPGDPL R PP Sbjct: 33 LFLDLISNSCSPGDPLVLERPPP 55 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.1 bits (67), Expect = 0.72 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIRRPTIQARKSNSCSPGDPLVLERPPP 39 >SB_13669| Best HMM Match : zf-CCHC (HMM E-Value=1.3e-06) Length = 385 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -2 Query: 302 QCFNCCRFGHTRVQCRSKPRCNKCGGEHSGLACNTETFSCVNCRGEHMATN 150 +C NC + GH V CRS + ++ E G N GE TN Sbjct: 273 KCLNCGKTGHYAVVCRSNKQVHEVNREEEGSYQEDYYLDDCNFMGEVSTTN 323 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 0.72 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS A+ + + NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS---ANIILIKITSNSCSPGDPLVLERPPP 36 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.72 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 6/42 (14%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVP----NSCSPGDPLF--RAPP 3 KH + LIS K F +++ NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS-ANIEKRFRVIIAVRRSNSCSPGDPLVLERPPP 42 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +2 Query: 5 AAL*IVDPPGCRNSARG 55 AAL +VDPPGCRNS G Sbjct: 28 AALELVDPPGCRNSIDG 44 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.1 bits (67), Expect = 0.72 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = -2 Query: 71 SKLFPILVPNSCSPGDPLF--RAPP 3 + LF I NSCSPGDPL R PP Sbjct: 55 NNLFIITTSNSCSPGDPLVLERPPP 79 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -2 Query: 104 MSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 +SQ + S +F + NSCSPGDPL R PP Sbjct: 28 LSQRKAKKRVLSAVFETVPSNSCSPGDPLVLERPPP 63 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.1 bits (67), Expect = 0.72 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS + ++ NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS-ANINTQSKLVASNSCSPGDPLVLERPPP 38 >SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18) Length = 1138 Score = 31.1 bits (67), Expect = 0.72 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = -2 Query: 359 RVYSFFSSIPVEQYIYPTVQCFNCCRFGHTRVQCR--SKPRCNKCGG-EHSGLACNTETF 189 R+ +F P +Q + V+C C + GH CR +C KCG H + C ++ Sbjct: 139 RILTFILDNPSKQNSF--VRCHRCNKQGHKAADCRCSKNHQCEKCGKIGHFKVCCKSKQT 196 Query: 188 S 186 S Sbjct: 197 S 197 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.1 bits (67), Expect = 0.72 Identities = 19/39 (48%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPI-LVPNSCSPGDPLF--RAPP 3 KH + LIS S+ + V NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIFSEPKRVNAVSNSCSPGDPLVLERPPP 40 >SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 0.72 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFP--ILVPNSCSPGDPLF--RAPP 3 KH + LIS P + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIWCSYSPPPVFTSNSCSPGDPLVLERPPP 41 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 30.7 bits (66), Expect = 0.96 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +2 Query: 5 AAL*IVDPPGCRNSARG 55 AAL +VDPPGCRNS G Sbjct: 11 AALELVDPPGCRNSMIG 27 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 30.7 bits (66), Expect = 0.96 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -1 Query: 90 HIIPRSL*IVSYPRAEFLQPGGSTI*SAA 4 H+I RS+ + + + EFLQPGGST AA Sbjct: 80 HMITRSMRPLVFGKIEFLQPGGSTSSRAA 108 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 0.96 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +LV NSCSPGDPL R PP Sbjct: 16 LLVSNSCSPGDPLVLERPPP 35 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.7 bits (66), Expect = 0.96 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS I++ NSCSPGDPL R PP Sbjct: 2 KHFTDTLISAN-------IIISNSCSPGDPLVLERPPP 32 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.7 bits (66), Expect = 0.96 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -2 Query: 152 NKSCPEFSRQTNIKKHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 N++ + T Q I E F L+ NSCSPGDPL R PP Sbjct: 7 NRTVSTLLQNTGSCSLYQQYRIGKSENLWTFKHLISNSCSPGDPLVLERPPP 58 >SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1203 Score = 30.7 bits (66), Expect = 0.96 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 275 HTRVQCRSKPRCNKCGGEHSGLACN 201 H +CRSK C C G H CN Sbjct: 581 HRADRCRSKTNCQNCDGRHHTSKCN 605 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 0.96 Identities = 19/38 (50%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS A+ V NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIANAK----VSNSCSPGDPLVLERPPP 35 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 +H+ + L+ Y +++ L NSCSPGDPL R PP Sbjct: 194 EHIPRFLLRYYGSAQNGKHLRSNSCSPGDPLVLERPPP 231 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -2 Query: 113 KKHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 ++ L S Q+ + + I + NSCSPGDPL R PP Sbjct: 47 RRRRRYQLGSRQDLNIIQKIKISNSCSPGDPLVLERPPP 85 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 104 MSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 +S N+++Y FP NSCSPGDPL R PP Sbjct: 9 ISANILTYSFCIVEFP--GSNSCSPGDPLVLERPPP 42 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 11 AALELVDPPGCRNSIK 26 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 11 AALELVDPPGCRNSMK 26 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS +L NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIPHELLAP-TSNSCSPGDPLVLERPPP 38 >SB_16910| Best HMM Match : EGF (HMM E-Value=0) Length = 1552 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/54 (27%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -2 Query: 293 NCCRFGHTRVQCRS---KPRCNKCGGEHSGLACNTETFSCVNCRGEHMATNKSC 141 N CR+G ++Q + K CN C H C NC +N C Sbjct: 1181 NLCRYGDNQLQSHNTTVKEDCNTCSCVHGTRTCTKVVCGPDNCLNSSTVSNDIC 1234 >SB_13566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKC 231 C+NC H +C SK RC +C Sbjct: 314 CYNCLSSSHISSKCTSKFRCRQC 336 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS I++ NSCSPGDPL R PP Sbjct: 2 KHFTDTLISAN-------IVISNSCSPGDPLVLERPPP 32 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 11 AALELVDPPGCRNSIK 26 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 11 AALELVDPPGCRNSMK 26 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 6/42 (14%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVP----NSCSPGDPLF--RAPP 3 KH + LIS +L+ L NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANITYRLYKRLSKSKRSNSCSPGDPLVLERPPP 43 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 66 AALELVDPPGCRNSMK 81 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 11 AALELVDPPGCRNSIK 26 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 11 AALELVDPPGCRNSIK 26 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/22 (68%), Positives = 16/22 (72%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 FP L+ NSCSPGDPL R PP Sbjct: 22 FP-LISNSCSPGDPLVLERPPP 42 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 IL+ NSCSPGDPL R PP Sbjct: 5 ILLSNSCSPGDPLVLERPPP 24 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +LV NSCSPGDPL R PP Sbjct: 4 MLVSNSCSPGDPLVLERPPP 23 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +LV NSCSPGDPL R PP Sbjct: 1 MLVSNSCSPGDPLVLERPPP 20 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS + + PI NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS----ANIGPI-TSNSCSPGDPLVLERPPP 34 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/43 (48%), Positives = 24/43 (55%), Gaps = 7/43 (16%) Frame = -2 Query: 110 KHMSQNLISYQEASK---LFPI--LVPNSCSPGDPLF--RAPP 3 KH + LIS ++ L P LV NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIPTRYAILSPRARLVSNSCSPGDPLVLERPPP 44 >SB_22648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 168 TSTVNTRKSLSITSQSAVLSTTFITSRFAPALNTSVSKATTIETL 302 TST NT + S T+ + STT TS NTS + +TT T+ Sbjct: 47 TSTTNTSTTTSTTTSTTNTSTT--TSTTTSTTNTSTTTSTTTTTI 89 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +3 Query: 168 TSTVNTRKSLSITSQSAVLSTTFITSRFAPALNTSVSKATTIET 299 TST NT + S T+ + STT TS NTS + +TT T Sbjct: 8 TSTTNTSTTTSTTTSTTNTSTT--TSTTTSTTNTSTTTSTTTST 49 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +3 Query: 168 TSTVNTRKSLSITSQSAVLSTTFITSRFAPALNTSVSKATTIET 299 TST NT + S T+ + STT TS NTS + +TT T Sbjct: 21 TSTTNTSTTTSTTTSTTNTSTT--TSTTTSTTNTSTTTSTTTST 62 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +3 Query: 168 TSTVNTRKSLSITSQSAVLSTTFITSRFAPALNTSVSKATTIET 299 TST NT + S T+ + STT TS NTS + +TT T Sbjct: 34 TSTTNTSTTTSTTTSTTNTSTT--TSTTTSTTNTSTTTSTTTST 75 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS A+ + + NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS---ANIVLSRVSSNSCSPGDPLVLERPPP 36 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -2 Query: 104 MSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 +S N+I+ F V NSCSPGDPL R PP Sbjct: 9 ISANIIAVHIDVVPFYCYVSNSCSPGDPLVLERPPP 44 >SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -2 Query: 305 VQCFNCCRFGHTRVQCRSKP--RCNKCGGEHSG 213 V+C C + GH V CRSKP R ++ H G Sbjct: 185 VRCDKCTKVGHFAVVCRSKPNTRVSQVEDAHEG 217 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -2 Query: 92 LISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 L+SY + + ++ NSCSPGDPL R PP Sbjct: 413 LVSYGINAYWYRMVSSNSCSPGDPLVLERPPP 444 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +2 Query: 5 AAL*IVDPPGCRNSAR 52 AAL +VDPPGCRNS + Sbjct: 11 AALELVDPPGCRNSMK 26 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/19 (73%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 LV NSCSPGDPL R PP Sbjct: 24 LVSNSCSPGDPLVLERPPP 42 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -2 Query: 110 KHMSQNLISYQ-EASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS + K NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIDLQKRRSKRASNSCSPGDPLVLERPPP 40 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/19 (73%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 LV NSCSPGDPL R PP Sbjct: 3 LVSNSCSPGDPLVLERPPP 21 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) Length = 1287 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = -2 Query: 302 QCFNCCRFGH--TRVQCRSKPR-CNKCGGE-HSGLACNT 198 +CFNC R GH C +K + CN CG + H C T Sbjct: 1226 RCFNCNRTGHIARNPVCPAKSQNCNSCGIKGHFSACCKT 1264 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 31 AALELVDPPGCRNS 44 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) Length = 1082 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 314 YPTVQCFNCCRFGHTRVQCRSKP 246 + +CF C + GH CRSKP Sbjct: 233 FKLAKCFKCSKVGHIANACRSKP 255 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 239 NKCGGEHSGLACNTETFSCVNCRGEHMATN 150 NK G G NTE SC C+G+H A+N Sbjct: 204 NKLGTARKG---NTEEPSCYRCKGKHYASN 230 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 87 AALELVDPPGCRNS 100 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 655 AALELVDPPGCRNS 668 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 F + V NSCSPGDPL R PP Sbjct: 36 FVLRVSNSCSPGDPLVLERPPP 57 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 28 AALELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 68 AALELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_9510| Best HMM Match : Keratin_B2 (HMM E-Value=3.8e-05) Length = 500 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCG 228 CF C R GH R CR +C G Sbjct: 75 CFGCLRGGHQRRSCRRSQKCGVDG 98 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILV--PNSCSPGDPLF--RAPP 3 KH + LIS ++ ++ NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANIGHVVYINIIRQSNSCSPGDPLVLERPPP 41 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_55492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1303 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = -2 Query: 344 FSSIPVEQ---YIYPTVQCFNCCRFGHTRVQCRSKPRCNK--CGGEHSGL 210 F S P+++ +Y C NC + GH C S RC K CG +H L Sbjct: 111 FKSKPLKERRKIVYNKRLCRNCLKEGHFADSCPSSGRCLKEGCGLKHHTL 160 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 65 LFPILVPNSCSPGDPLF--RAPP 3 L+ L NSCSPGDPL R PP Sbjct: 2 LYNTLASNSCSPGDPLVLERPPP 24 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 ++V NSCSPGDPL R PP Sbjct: 6 VVVSNSCSPGDPLVLERPPP 25 >SB_49583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 311 PTVQCFNCCRFGHTRVQCRSKPRCNKCG 228 P C+ C + GH C +C KCG Sbjct: 119 PGESCYRCGKSGHFARDCTDDTKCYKCG 146 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +++ NSCSPGDPL R PP Sbjct: 4 VIISNSCSPGDPLVLERPPP 23 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 48 AALELVDPPGCRNS 61 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 11 AALELVDPPGCRNS 24 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -2 Query: 95 NLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 NLI K + NSCSPGDPL RAPP Sbjct: 7 NLIENISFPKSADVNGSNSCSPGDPLVLERAPP 39 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = -2 Query: 86 SYQEASKL--FPILVPNSCSPGDPLF--RAPP 3 +Y+ SKL I NSCSPGDPL R PP Sbjct: 25 AYKNCSKLNKTAIKASNSCSPGDPLVLERPPP 56 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -2 Query: 80 QEASKLFPILVPNSCSPGDPLF--RAPP 3 +E L +V NSCSPGDPL R PP Sbjct: 76 EECLTLTQRIVSNSCSPGDPLVLERPPP 103 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 F +L NSCSPGDPL R PP Sbjct: 8 FIMLASNSCSPGDPLVLERPPP 29 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -2 Query: 59 PILVPNSCSPGDPLF--RAPP 3 P++ NSCSPGDPL R PP Sbjct: 26 PLVPSNSCSPGDPLVLERPPP 46 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 98 AALELVDPPGCRNS 111 >SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1957 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = -2 Query: 302 QCFNCCRFGHTRVQ--CRSKPR-CNKCGGE-HSGLACNT 198 +CFNC R GH C +K + CN CG + H C T Sbjct: 931 RCFNCNRTGHIARDPVCPAKSQSCNSCGIKGHFSACCKT 969 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 5 AAL*IVDPPGCRNS 46 AAL +VDPPGCRNS Sbjct: 74 AALELVDPPGCRNS 87 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -2 Query: 128 RQTNIKKHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 R+ +++ M S++ ++K P + NSCSPGDPL R PP Sbjct: 22 RRCHVRVFMPATATSFRTSNK--PT-ISNSCSPGDPLVLERPPP 62 >SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) Length = 1382 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRC 240 CF+C R GH + +C SK +C Sbjct: 1130 CFSCLRRGHHQRECGSKKKC 1149 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 65 LFPILVPNSCSPGDPLF--RAPP 3 +F + NSCSPGDPL R PP Sbjct: 1 MFALSASNSCSPGDPLVLERPPP 23 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = -2 Query: 59 PILVPNSCSPGDPLF--RAPP 3 P+ NSCSPGDPL R PP Sbjct: 7 PVPASNSCSPGDPLVLERPPP 27 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 F I+ NSCSPGDPL R PP Sbjct: 8 FWIVTSNSCSPGDPLVLERPPP 29 >SB_10083| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1457 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = +3 Query: 117 ICLSTKLRARFVCSHMFTSTVNTRKSLSI----TSQSAVLSTTFITSRFAPALNTSVSKA 284 + LS + VCSH F+ + S+SI T+ S L+ S F A +TSV Sbjct: 132 LTLSRRESDTSVCSHSFSLHAEAKSSVSIDEILTTSSVTLTVPGSPSGFIAAAHTSVRAT 191 Query: 285 TTI 293 T++ Sbjct: 192 TSL 194 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 8 LISNSCSPGDPLVLERPPP 26 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -2 Query: 98 QNLISYQEASKLFPIL-VPNSCSPGDPLF--RAPP 3 Q I Y P++ + NSCSPGDPL R PP Sbjct: 18 QKTIPYPAVRTQKPVIFLSNSCSPGDPLVLERPPP 52 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/43 (46%), Positives = 22/43 (51%), Gaps = 7/43 (16%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILV-----PNSCSPGDPLF--RAPP 3 KH + LIS S +F V NSCSPGDPL R PP Sbjct: 2 KHFTDTLIS-ANISDIFTTFVFDPNTSNSCSPGDPLVLERPPP 43 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +L NSCSPGDPL R PP Sbjct: 16 VLASNSCSPGDPLVLERPPP 35 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 + ++ NSCSPGDPL R PP Sbjct: 7 YKVITSNSCSPGDPLVLERPPP 28 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS I V NSCSPGDPL R PP Sbjct: 2 KHFTDTLISAN-------ISVSNSCSPGDPLVLERPPP 32 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +L NSCSPGDPL R PP Sbjct: 36 VLTSNSCSPGDPLVLERPPP 55 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 7/43 (16%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVP-----NSCSPGDPLF--RAPP 3 KH + LIS + L P+ + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANISPILPPLSLSRYAGSNSCSPGDPLVLERPPP 44 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/20 (70%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 I V NSCSPGDPL R PP Sbjct: 30 IAVSNSCSPGDPLVLERPPP 49 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 34 LISNSCSPGDPLVLERPPP 52 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -2 Query: 77 EASKLFPILVPNSCSPGDPLF--RAPP 3 +AS L +L NSCSPGDPL R PP Sbjct: 82 DASNL--LLTSNSCSPGDPLVLERPPP 106 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 11/53 (20%) Frame = -2 Query: 128 RQTNIKKHMSQNLISYQEA---SKLFPILVP------NSCSPGDPLF--RAPP 3 RQ N ++H +Q L + A KL + +P NSCSPGDPL R PP Sbjct: 3 RQRNDRRHATQLLETPSIAIATHKLNTLFIPSTQMASNSCSPGDPLVLERPPP 55 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 65 LFPILVPNSCSPGDPLF--RAPP 3 LF V NSCSPGDPL R PP Sbjct: 3 LFCEAVSNSCSPGDPLVLERPPP 25 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 33 LISNSCSPGDPLVLERPPP 51 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +++ NSCSPGDPL R PP Sbjct: 25 LIISNSCSPGDPLVLERPPP 44 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 L+ NSCSPGDPL R PP Sbjct: 31 LISNSCSPGDPLVLERPPP 49 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +L NSCSPGDPL R PP Sbjct: 3 VLASNSCSPGDPLVLERPPP 22 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 +V NSCSPGDPL R PP Sbjct: 347 IVSNSCSPGDPLVLERPPP 365 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 + V NSCSPGDPL R PP Sbjct: 8 LFVSNSCSPGDPLVLERPPP 27 >SB_47175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1088 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGE-HSGL 210 CF C H C +K +C+ C E H+GL Sbjct: 464 CFRCFDPAHVARDCATKIKCSVCADELHNGL 494 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 110 KHMSQNLISYQ--EASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS S + + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISANILRFSIFWTDRLSNSCSPGDPLVLERPPP 41 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = -2 Query: 77 EASKLFPILVPNSCSPGDPLF--RAPP 3 E L L NSCSPGDPL R PP Sbjct: 7 ETDALPTALTSNSCSPGDPLVLERPPP 33 >SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15) Length = 385 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +3 Query: 90 EVLRHMFF-NICLSTKLRARFVCSHMFTSTVNTRKSLSITSQSAVLSTTFITSRFAPALN 266 E+ H F N K + +C+++ + KSL + + A + FIT LN Sbjct: 25 EIYEHYFAANKITEDKFKVSILCANVGPKAYHIIKSLCLPEKPADKTFEFITKAVNITLN 84 Query: 267 TSVSKATTIETLYR 308 S K + TL R Sbjct: 85 RSFPKRARVFTLTR 98 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS I + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISAN-------IFLSNSCSPGDPLVLERPPP 32 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = -2 Query: 59 PILVPNSCSPGDPLF--RAPP 3 P + NSCSPGDPL R PP Sbjct: 56 PSSISNSCSPGDPLVLERPPP 76 >SB_22124| Best HMM Match : Ion_trans_2 (HMM E-Value=1.6e-14) Length = 307 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 162 MFTSTVNTRKSLSITSQSAVLSTTFITSRFAPALNTSVSKATTIETLYRW 311 +F S T KSL I + + T+F T + + + T IE+LY W Sbjct: 150 VFKSNDITAKSLKIKTLVLSMVTSFTTIGIFAVVQSYIEDWTVIESLYAW 199 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 110 KHMSQNLISYQEASKLFPILVPNSCSPGDPLF--RAPP 3 KH + LIS I + NSCSPGDPL R PP Sbjct: 2 KHFTDTLISAN-----IDIPLSNSCSPGDPLVLERPPP 34 >SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 890 Score = 29.1 bits (62), Expect = 2.9 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -2 Query: 305 VQCFNCCRFGHTRVQCRSKP--RCNKCGGEHSG-LACNTETFSCVNCRGEHMATNKSCPE 135 V+C C + GH CRSKP R ++ H G + + TF V T+ + P+ Sbjct: 86 VRCDKCTKVGHFDAVCRSKPNTRVSQVEDAHEGEVLQHNPTF--VGQVLAVSQTDNTLPD 143 Query: 134 FSRQTNIKKHMSQNLISYQEA 72 + N+ S+N +S EA Sbjct: 144 --QDKNVNTTSSENQVSEAEA 162 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 1 GGGALNSGSPGLQEFGTR 54 GG + SGSPGLQEF T+ Sbjct: 9 GGRSRTSGSPGLQEFDTK 26 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +L NSCSPGDPL R PP Sbjct: 77 LLTSNSCSPGDPLVLERPPP 96 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 1 GGGALNSGSPGLQEFGTR 54 GG + SGSPGLQEF T+ Sbjct: 9 GGRSRTSGSPGLQEFDTK 26 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 +V NSCSPGDPL R PP Sbjct: 77 IVSNSCSPGDPLVLERPPP 95 >SB_6211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 302 QCFNCCRFGHTRVQ--CRSKPR-CNKCGGEHSGLAC 204 +CFNC R GH C +K + CN CG + AC Sbjct: 221 RCFNCNRTGHIARDPVCPAKSQNCNSCGIKSHFSAC 256 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 +L NSCSPGDPL R PP Sbjct: 4 LLASNSCSPGDPLVLERPPP 23 >SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) Length = 1693 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 299 CFNCCRFGHTRVQCRSKPRCNKCGGE-HSGL 210 CF C H C +K +C+ C E H+GL Sbjct: 638 CFRCFDPAHVARDCATKIKCSVCADERHNGL 668 >SB_51991| Best HMM Match : UPF0185 (HMM E-Value=3.3e-14) Length = 334 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -2 Query: 404 TQTVVLTFDGQSLPSRVYSFFSSIPVEQYI-YPTVQCFNCCRFGHTRVQCRSK 249 T + LT D + LP +V S + P + + +C NC + GH + C+SK Sbjct: 22 TFKITLTSDPK-LPYKVLSVPENTPFTAVLRFAAEECDNCGKVGHLKRVCQSK 73 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/28 (57%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = -2 Query: 77 EASKLFPIL-VPNSCSPGDPLF--RAPP 3 E S L P + NSCSPGDPL R PP Sbjct: 22 ENSSLKPTFSISNSCSPGDPLVLERPPP 49 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 +V NSCSPGDPL R PP Sbjct: 11 MVSNSCSPGDPLVLERPPP 29 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +1 Query: 103 ICFLIFVCLLNSGQDLFVAICSPLQLTQEKVSVLQASPLCSPPXXXXXXXXXXXTRVC 276 +C +F CL ++ L V +C P+ + +SV SP+CS RVC Sbjct: 1075 VCSRVFTCL-SACVHLSVRVCLPVCFSCVHLSVRVLSPVCSRVFTCLYACVHLSVRVC 1131 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +1 Query: 103 ICFLIFVCLLNSGQDLFVAICSPLQLTQEKVSVLQASPLCSPPXXXXXXXXXXXTRVC 276 +C +F CL + +L V +C P+ + +SV SP+CS RVC Sbjct: 1186 VCPRVFTCLY-ACVNLSVCVCLPVCFSCVHLSVRVRSPVCSRAFTCLSACVHLSVRVC 1242 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 +V NSCSPGDPL R PP Sbjct: 1 MVSNSCSPGDPLVLERPPP 19 >SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 1 GGGALNSGSPGLQEFGTRIG 60 GG + SGSPGLQEF +G Sbjct: 9 GGRSRTSGSPGLQEFDVGVG 28 >SB_37538| Best HMM Match : zf-CCHC (HMM E-Value=0.0011) Length = 215 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -2 Query: 305 VQCFNCCRFGHTRVQCRSKP--RCNKCGGEHSG 213 V+C C + GH CRSKP R ++ H G Sbjct: 93 VRCDKCTKVGHIAAVCRSKPNTRVSQVEDAHEG 125 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 I+ NSCSPGDPL R PP Sbjct: 24 IITSNSCSPGDPLVLERPPP 43 >SB_23731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1133 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 317 IYPTVQCFNCCRFGHTRVQCRSKPRCNK--CGGEHSGL 210 +Y C NC + GH C S RC K CG +H L Sbjct: 183 VYNKRLCRNCLKEGHFADSCPSSGRCLKEGCGLKHHTL 220 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -2 Query: 71 SKLFPILVPNSCSPGDPLF--RAPP 3 S +F NSCSPGDPL R PP Sbjct: 3 SVMFKRFASNSCSPGDPLVLERPPP 27 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 +V NSCSPGDPL R PP Sbjct: 13 IVSNSCSPGDPLVLERPPP 31 >SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 765 Score = 29.1 bits (62), Expect = 2.9 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -2 Query: 305 VQCFNCCRFGHTRVQCRSKP--RCNKCGGEHSG-LACNTETFSCVNCRGEHMATNKSCPE 135 V+C C + GH CRSKP R ++ H G + + TF V T+ + P+ Sbjct: 68 VRCDKCTKVGHFDAVCRSKPNTRVSQVEDAHEGEVLQHNPTF--VGQVLAVSQTDNTLPD 125 Query: 134 FSRQTNIKKHMSQNLISYQEA 72 + N+ S+N +S EA Sbjct: 126 --QDKNVNTTSSENQVSEAEA 144 >SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 1 GGGALNSGSPGLQEFGTRIGNNLEA 75 GG + SGSPGLQEF + + EA Sbjct: 9 GGRSRTSGSPGLQEFDDLVADAYEA 33 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 +V NSCSPGDPL R PP Sbjct: 6 IVSNSCSPGDPLVLERPPP 24 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/20 (65%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -2 Query: 56 ILVPNSCSPGDPLF--RAPP 3 + V NSCSPGDPL R PP Sbjct: 8 VTVSNSCSPGDPLVLERPPP 27 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -1 Query: 57 YPRAEFLQPGGSTI*SAA 4 YP EFLQPGGST AA Sbjct: 32 YPNIEFLQPGGSTSSRAA 49 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 65 LFPILVPNSCSPGDPLF--RAPP 3 L L+ NSCSPGDPL R PP Sbjct: 3 LSSFLLSNSCSPGDPLVLERPPP 25 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -2 Query: 53 LVPNSCSPGDPLF--RAPP 3 +V NSCSPGDPL R PP Sbjct: 1 MVSNSCSPGDPLVLERPPP 19 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 62 FPILVPNSCSPGDPLF--RAPP 3 F ++ NSCSPGDPL R PP Sbjct: 9 FYFILSNSCSPGDPLVLERPPP 30 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = -2 Query: 104 MSQNLISYQE-ASKLFPILVPNSCSPGDPLF--RAPP 3 +S N++ +E + +V NSCSPGDPL R PP Sbjct: 9 ISANIVFLREFVYTVIQKVVSNSCSPGDPLVLERPPP 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,358,830 Number of Sequences: 59808 Number of extensions: 465152 Number of successful extensions: 3063 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3058 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -