BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0996 (641 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 24 1.2 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 23 1.6 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 23 1.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.8 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 3.7 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 23.8 bits (49), Expect = 1.2 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -2 Query: 433 YIQPFIYLKFYDKITPVTIYYQNILD 356 ++ F + FY + P+ + Q ILD Sbjct: 360 FVSTFFKIPFYSTLRPINLLVQIILD 385 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -2 Query: 466 FAIRVYTFMNEYIQPFIYLKFYDKITPVTIYYQNILD 356 F + Y + + F + FY + P+ + Q ILD Sbjct: 30 FMVAFYVVFSS-VSTFFKIPFYSTLRPINLLVQIILD 65 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -2 Query: 466 FAIRVYTFMNEYIQPFIYLKFYDKITPVTIYYQNILD 356 F + Y + + F + FY + P+ + Q ILD Sbjct: 30 FMVAFYVVFSS-VSTFFKIPFYSTLRPINLLVQIILD 65 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 2.8 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -1 Query: 287 ITLMKIYYI*ITKVLIYLHTAVAILLLFRIYMRTVQIFLIYFIFNTL 147 I L+ IYY +L +H + + + + YM +F FI T+ Sbjct: 233 IILLCIYYFYYAFILFTVHLLLLVCIYYFYYMHL--LFCCAFIIFTM 277 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 358 LKCSDNK*LQVLFYHRI 408 L+C D K ++YHRI Sbjct: 343 LQCQDEKFESFVYYHRI 359 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,436 Number of Sequences: 336 Number of extensions: 3576 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -