BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0992 (595 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 23 2.6 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 4.5 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.8 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 323 IFVYEIPFYILLLFHCDFSSSKEQ*HYTSYN 415 ++ Y IP Y+ L H +S + T Y+ Sbjct: 1 MYSYLIPLYLFLFVHYGWSEDTTHKYTTKYD 31 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 323 IFVYEIPFYILLLFHCDFSSSKEQ 394 +FVY + IL++ CD +S + Sbjct: 217 VFVYTLVSVILIIMGCDVVASNSR 240 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 583 QIYNYYIIDLTQKVHL 536 +IY +Y + +T VHL Sbjct: 55 RIYYFYCVSITFNVHL 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,034 Number of Sequences: 336 Number of extensions: 2962 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -