BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0992 (595 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0575 - 18876988-18877029,18877072-18877102,18878290-188784... 28 4.9 04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276 27 8.5 >08_02_0575 - 18876988-18877029,18877072-18877102,18878290-18878418, 18878512-18879154,18882042-18883990,18884964-18885040 Length = 956 Score = 28.3 bits (60), Expect = 4.9 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = +3 Query: 21 HEGLISIKQLFCEDRYRCIDVDNVIINYLKKKTI 122 H G++ + + C D V ++++N++K+K + Sbjct: 237 HRGILETEHISCSDEVVSCTVHDMVLNFIKRKAM 270 >04_04_1627 - 34867557-34870095,34870159-34870391,34871274-34871276 Length = 924 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 325 YIVGLTQYAQD*RRIKFPDSFQSCGQIYNVKIILSRY 215 Y+ L Y + R I D F CGQI K+++ RY Sbjct: 703 YVSHLPSYVNNERLI---DLFLPCGQITQAKVVVERY 736 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,271,287 Number of Sequences: 37544 Number of extensions: 204025 Number of successful extensions: 265 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -