BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0991 (567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 26 0.30 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.6 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.8 bits (54), Expect = 0.30 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +2 Query: 338 IYRVYTPSVQYCYSE*FCISERYYFFYVW--TILNYYFFTCVRYLKLCTYYYLMNVGSLG 511 IY +++ Y + E FCI + + T+L FT RY+ +C + + L Sbjct: 111 IYYIWS-HFPYVFGEAFCIIQSFAAETSANATVLTITAFTVERYIAICHPFISHTMSKLS 169 Query: 512 RRKKALIKV 538 R K +I + Sbjct: 170 RAVKFIIVI 178 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 272 LTGVNDSCQVNRHREVVCST 331 LTG+ND+ N + C+T Sbjct: 671 LTGINDARLRNTMENLTCAT 690 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,911 Number of Sequences: 438 Number of extensions: 4024 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -