BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0985 (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 6.7 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 8.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 8.9 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 6.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 329 KLLKLMKKPMCFFTYLLSSKFTNPLMRFYQETQ 427 K KLM K M TY+L ++ + F ET+ Sbjct: 403 KTAKLMAKSMKSPTYVLKFEYRSMNSWFEHETE 435 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 105 VRSSYIQSKIEHCTII 152 ++S S +EHCT+I Sbjct: 169 IKSLRQSSSLEHCTLI 184 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 400 IDEVLSRDPALIGYDTSK 453 +DE+ SRDP I D K Sbjct: 1333 VDELRSRDPIKIVADLQK 1350 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 400 IDEVLSRDPALIGYDTSK 453 +DE+ SRDP I D K Sbjct: 1333 VDELRSRDPIKIVADLQK 1350 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 224 VNLFNRFCTFGVKNF 180 V+ RFCT+G N+ Sbjct: 7 VHSLERFCTYGNVNY 21 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,406 Number of Sequences: 336 Number of extensions: 3009 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -