BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0985 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 24 2.7 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 3.6 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 6.3 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 6.3 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 8.4 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 23 8.4 AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha su... 23 8.4 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 23 8.4 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 23 8.4 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 23 8.4 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 23 8.4 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 24.2 bits (50), Expect = 2.7 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 379 VLKIHKPIDEVLSRDPALIGYDTSKYLFTDITFGIA-NEER 498 +LKI+K + ++S D + G DT+ T + + +A N E+ Sbjct: 307 LLKINKHVAVIMSLDMLIAGIDTTSSGSTGVLYCLAKNPEK 347 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 3.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 339 FSNFQFKLFFREKLIFGSFKGM*T 268 +SN QF +KL+FG KG+ T Sbjct: 29 WSNRQFPTLPNQKLLFGHVKGVNT 52 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 6.3 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +1 Query: 220 LTRPDFTKVFRKRNNQGLHALKTPKYKFLTKEELELEIAKANEKADV 360 + RP + + RK ++ LHA P Y T + +A K D+ Sbjct: 360 MKRPPYIENHRKLLSKDLHACFYPYYSTTTLNRIARFTNRAPSKEDL 406 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 6.3 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +1 Query: 220 LTRPDFTKVFRKRNNQGLHALKTPKYKFLTKEELELEIAKANEKADV 360 + RP + + RK ++ LHA P Y T + +A K D+ Sbjct: 360 MKRPPYIENHRKLLSKDLHACFYPYYSTTTLNRIARFTNRAPSKEDL 406 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 82 F*HASLQFFCNSKDILAFKI 23 F H+S+ F N KD+L KI Sbjct: 258 FQHSSVILFLNKKDLLEEKI 277 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 82 F*HASLQFFCNSKDILAFKI 23 F H+S+ F N KD+L KI Sbjct: 115 FQHSSVILFLNKKDLLEEKI 134 >AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha subunit AgGq5 protein. Length = 127 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 82 F*HASLQFFCNSKDILAFKI 23 F H+S+ F N KD+L KI Sbjct: 72 FQHSSVILFLNKKDLLEEKI 91 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 82 F*HASLQFFCNSKDILAFKI 23 F H+S+ F N KD+L KI Sbjct: 72 FQHSSVILFLNKKDLLEEKI 91 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 82 F*HASLQFFCNSKDILAFKI 23 F H+S+ F N KD+L KI Sbjct: 71 FQHSSVILFLNKKDLLEEKI 90 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 82 F*HASLQFFCNSKDILAFKI 23 F H+S+ F N KD+L KI Sbjct: 72 FQHSSVILFLNKKDLLEEKI 91 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 82 F*HASLQFFCNSKDILAFKI 23 F H+S+ F N KD+L KI Sbjct: 71 FQHSSVILFLNKKDLLEEKI 90 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,686 Number of Sequences: 2352 Number of extensions: 11535 Number of successful extensions: 24 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -