BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0985 (528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50170.1 68416.m05485 hypothetical protein contains Pfam prof... 31 0.63 At3g20720.1 68416.m02622 expressed protein 29 2.6 At5g43840.1 68418.m05360 heat shock transcription factor family ... 28 3.4 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 28 3.4 At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein ki... 28 3.4 At1g30420.1 68414.m03718 ATP-binding cassette transport protein,... 28 3.4 At1g69920.1 68414.m08046 glutathione S-transferase, putative sim... 28 4.5 At1g14610.1 68414.m01737 valyl-tRNA synthetase / valine--tRNA li... 28 4.5 At1g80750.1 68414.m09474 60S ribosomal protein L7 (RPL7A) simila... 27 5.9 At5g04510.2 68418.m00450 3-phosphoinositide-dependent protein ki... 27 7.8 At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein ki... 27 7.8 At1g12550.1 68414.m01455 oxidoreductase family protein similar t... 27 7.8 At1g05150.1 68414.m00518 calcium-binding EF hand family protein ... 27 7.8 >At3g50170.1 68416.m05485 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 541 Score = 30.7 bits (66), Expect = 0.63 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +1 Query: 190 TPNVQNLLKRLTRPDFTKVFRKRNNQGLHAL 282 TPN ++LLKRLTR T+V KR Q +H + Sbjct: 333 TPNTRSLLKRLTRN--TRVVDKRQQQLVHCV 361 >At3g20720.1 68416.m02622 expressed protein Length = 1083 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 281 LKLPNISFSRKKSLNWKLLKLMKKPMCF 364 L + N+SF+ +L +LL L K P CF Sbjct: 468 LHIENLSFAESPTLKVRLLNLEKDPACF 495 >At5g43840.1 68418.m05360 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 282 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 208 LLKRLTRPDFTKVFRKRNNQGL 273 LLK++ +P F + RKRN QG+ Sbjct: 173 LLKKIKKPSFLQSLRKRNLQGI 194 >At3g56990.1 68416.m06344 glycine-rich protein conserved hypothetical protein SPCC330.09 - Schizosaccharomyces pombe, PIR:T41319 Length = 711 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +1 Query: 136 NIVPSFYDGEQDPAPKFFTPNVQNLLKRLTRPDFTKVFRKRNNQGLHALKTPKYKFLTKE 315 +++PS++ E PAPK+ +P ++NL + L T ++ YKFL E Sbjct: 341 SLIPSYFIPELGPAPKWCSP-LENLTEELEESAQTTIY-------------DNYKFLAME 386 Query: 316 ELE 324 +LE Sbjct: 387 DLE 389 >At3g10540.1 68416.m01265 3-phosphoinositide-dependent protein kinase, putative similar to 3-phosphoinositide-dependent protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166 Length = 486 Score = 28.3 bits (60), Expect = 3.4 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Frame = +1 Query: 235 FTKVFR--KRNNQGLHALKTPKYKFLTKEELELEIAKANEKADVLLHIPPVLKIHKPIDE 408 ++KV R K++N ++ALK KF+TKE + D L H P ++K+ + Sbjct: 56 YSKVVRAKKKDNGTVYALKIMDKKFITKENKTAYVKLERIVLDQLEH-PGIVKLFFTFQD 114 Query: 409 VLSRDPALIGYDTSKYLFTDIT 474 S AL + + LF IT Sbjct: 115 TQSLYMALESCEGGE-LFDQIT 135 >At1g30420.1 68414.m03718 ATP-binding cassette transport protein, putative contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1488 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 355 DVLLHIPPVLKIHKPIDEVLSRDPALIGYDTSKYLFTDITFGI 483 D+ + PV+ H + ++ DPA +GY + +F +TFG+ Sbjct: 314 DLSQFVGPVILSHI-LQSMIEGDPAWVGYVYAFLIFFGVTFGV 355 >At1g69920.1 68414.m08046 glutathione S-transferase, putative similar to glutathione transferase GB:CAA09188 [Alopecurus myosuroides]; supported by cDNA gi:15451157 gb:AY050343. Length = 254 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 242 KFSARETIKVYMPLKLPNISFSRKK 316 KF A E +K YMP I F++KK Sbjct: 227 KFRAHEAVKPYMPTVAEFIEFAKKK 251 >At1g14610.1 68414.m01737 valyl-tRNA synthetase / valine--tRNA ligase (VALRS) nearly identical to SP|P93736 Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) {Arabidopsis thaliana} Length = 1108 Score = 27.9 bits (59), Expect = 4.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 195 WCKKLWSRVLFAIVK 151 WC KLW+ V FA++K Sbjct: 782 WCNKLWNAVRFAMMK 796 >At1g80750.1 68414.m09474 60S ribosomal protein L7 (RPL7A) similar to ribosomal protein L7 GB:AAA03081 GI:307388 from [Homo sapiens] Length = 247 Score = 27.5 bits (58), Expect = 5.9 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 292 KYKFLTKEELELEIAKANEKADVLLHIPPVLKIHKPIDEVLSR 420 ++K L E+L EIA+ + ++ LK++KP+ +VL R Sbjct: 179 EHKILGIEDLVNEIARVGDHFREVMRFLGPLKLNKPVADVLHR 221 >At5g04510.2 68418.m00450 3-phosphoinositide-dependent protein kinase, putative similar to 3-phosphoinositide-dependent protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166 Length = 408 Score = 27.1 bits (57), Expect = 7.8 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Frame = +1 Query: 235 FTKVFR--KRNNQGLHALKTPKYKFLTKEELELEIAKANEKADVLLHIPPVLKIHKPIDE 408 ++KV R K+ ++ALK KF+TKE + D L H P ++K++ + Sbjct: 55 YSKVVRAKKKETGTVYALKIMDKKFITKENKTAYVKLERIVLDQLEH-PGIIKLYFTFQD 113 Query: 409 VLSRDPALIGYDTSKYLFTDIT 474 S AL + + LF IT Sbjct: 114 TSSLYMALESCEGGE-LFDQIT 134 >At5g04510.1 68418.m00451 3-phosphoinositide-dependent protein kinase, putative similar to 3-phosphoinositide-dependent protein kinase-1 [Oryza sativa] gi|5001830|gb|AAD37166 Length = 491 Score = 27.1 bits (57), Expect = 7.8 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Frame = +1 Query: 235 FTKVFR--KRNNQGLHALKTPKYKFLTKEELELEIAKANEKADVLLHIPPVLKIHKPIDE 408 ++KV R K+ ++ALK KF+TKE + D L H P ++K++ + Sbjct: 55 YSKVVRAKKKETGTVYALKIMDKKFITKENKTAYVKLERIVLDQLEH-PGIIKLYFTFQD 113 Query: 409 VLSRDPALIGYDTSKYLFTDIT 474 S AL + + LF IT Sbjct: 114 TSSLYMALESCEGGE-LFDQIT 134 >At1g12550.1 68414.m01455 oxidoreductase family protein similar to glyoxylate reductase from Homo sapiens (gi:6002730); contains Pfam D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain PF02826 Length = 323 Score = 27.1 bits (57), Expect = 7.8 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 331 IAKANEKADVLLHIPPVLKIHKPIDEVLSRDPALIGYDTS 450 +A+++E VLLH PP L +DE+L+R+ + DTS Sbjct: 1 MAESSEPPVVLLHRPPSLTF---MDEILTREFRTLITDTS 37 >At1g05150.1 68414.m00518 calcium-binding EF hand family protein low similarity to O-linked GlcNAc transferase [Homo sapiens] GI:2266994; contains Pfam profiles PF00036: EF hand, PF00515: TPR Domain Length = 808 Score = 27.1 bits (57), Expect = 7.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +1 Query: 136 NIVPSFYDGEQDPAPKFFTPNVQNLLKRL---TRPDFTKVFRKRNNQGLHAL 282 N VP Y G P PN++ +L+RL +PD + K N+ + AL Sbjct: 560 NDVPVSYSGSGGPTKSIRKPNLEEILRRLLSSLKPDTFQGAIKAINEKILAL 611 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,342,771 Number of Sequences: 28952 Number of extensions: 237498 Number of successful extensions: 505 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -