BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0984 (604 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 33 0.005 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 24 4.4 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 33.5 bits (73), Expect = 0.005 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 27 DMARAREVAQSYNVPFVETSAKTRMGVDDAFYTLVREIRKDK 152 D A++ A + F+ETSAKT + V+D F + +++ K++ Sbjct: 148 DYEEAKQYADDNRLLFMETSAKTAVNVNDIFLAIAKKLPKNE 189 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +3 Query: 75 VETSAKTRMGVDDAFYTLVREIRKDKVSRDKKFKGKKPRHVHKIIK 212 +E++ DA V+EIR DK K+PR + ++++ Sbjct: 20 MESAEDAEAAKKDAELLAVQEIRDHARQIDKAVVSKEPRFILRVLR 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,095 Number of Sequences: 2352 Number of extensions: 14072 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -