BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0980 (590 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579,397... 28 4.8 >09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579, 3973665-3973982,3974565-3974763,3974937-3975202, 3975288-3975574,3976714-3977818,3977900-3978046, 3978146-3978226,3978315-3978540,3978622-3978761, 3979539-3979645,3979739-3979841 Length = 3638 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 428 TAAKIVKLSLRSVDFWGEGGGLSVYPCTIPTPRNPMVMKISTVIFF 565 +A+ KL S + G+ GGL + C++P+ +P+ +I + + F Sbjct: 71 SASLTSKLFAFSQGWGGKEGGLGLIACSLPSGCDPIATEIGSTLHF 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,357,809 Number of Sequences: 37544 Number of extensions: 315224 Number of successful extensions: 816 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 814 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -