BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0979 (600 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC002760-1|AAH02760.1| 182|Homo sapiens plasma membrane proteol... 31 3.1 AF137386-1|AAD33060.1| 182|Homo sapiens plasmolipin protein. 31 3.1 BC034502-1|AAH34502.1| 594|Homo sapiens choline dehydrogenase p... 31 4.1 AJ272267-1|CAB75961.1| 482|Homo sapiens choline dehydrogenase p... 31 4.1 AK124805-1|BAC85954.1| 189|Homo sapiens protein ( Homo sapiens ... 30 5.4 >BC002760-1|AAH02760.1| 182|Homo sapiens plasma membrane proteolipid (plasmolipin) protein. Length = 182 Score = 31.1 bits (67), Expect = 3.1 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 261 LWVITLQLIILLSYHIHMYILYVCLPIVSMI--MSLALIYKSTYI 133 LW++T+ L L + +HM + V P+V MI +S ++Y + +I Sbjct: 76 LWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFI 120 >AF137386-1|AAD33060.1| 182|Homo sapiens plasmolipin protein. Length = 182 Score = 31.1 bits (67), Expect = 3.1 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 261 LWVITLQLIILLSYHIHMYILYVCLPIVSMI--MSLALIYKSTYI 133 LW++T+ L L + +HM + V P+V MI +S ++Y + +I Sbjct: 76 LWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFI 120 >BC034502-1|AAH34502.1| 594|Homo sapiens choline dehydrogenase protein. Length = 594 Score = 30.7 bits (66), Expect = 4.1 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 599 NAPTIMIGEKGADLIK 552 NAPTIMI EK AD+IK Sbjct: 557 NAPTIMIAEKAADIIK 572 >AJ272267-1|CAB75961.1| 482|Homo sapiens choline dehydrogenase protein. Length = 482 Score = 30.7 bits (66), Expect = 4.1 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 599 NAPTIMIGEKGADLIK 552 NAPTIMI EK AD+IK Sbjct: 445 NAPTIMIAEKAADIIK 460 >AK124805-1|BAC85954.1| 189|Homo sapiens protein ( Homo sapiens cDNA FLJ42815 fis, clone BRCAN2014143. ). Length = 189 Score = 30.3 bits (65), Expect = 5.4 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 233 YFYHTTYICIYYMYVYLLFL 174 Y Y TYICI+ YVY+ ++ Sbjct: 151 YMYVRTYICIFMFYVYVFYM 170 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,191,988 Number of Sequences: 237096 Number of extensions: 1508274 Number of successful extensions: 5497 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5491 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -