BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0977 (572 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70330.1 68414.m08091 equilibrative nucleoside transporter fa... 32 0.31 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 29 1.7 At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:... 29 2.2 At1g08890.1 68414.m00989 sugar transporter family protein simila... 29 2.9 At5g50070.1 68418.m06200 invertase/pectin methylesterase inhibit... 28 3.8 At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-g... 28 3.8 At5g12120.1 68418.m01423 ubiquitin-associated (UBA)/TS-N domain-... 28 5.1 At3g27840.1 68416.m03472 50S ribosomal protein L12-2, chloroplas... 27 6.7 At1g29790.1 68414.m03642 expressed protein 27 6.7 At3g54570.1 68416.m06038 calmodulin-binding protein-related cont... 27 8.9 >At1g70330.1 68414.m08091 equilibrative nucleoside transporter family protein contains similarity to SWISS-PROT:Q14542 equilibrative nucleoside transporter 2 (Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter, Equilibrative NBMPR-insensitive nucleoside transporter, Nucleoside transporter, ei-type, 36 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, Delayed-early response protein 12) [Homo sapiens] Length = 450 Score = 31.9 bits (69), Expect = 0.31 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = -2 Query: 556 KDTLRGIAWRSSIWVVVNITRIFIRSIATVLFAVTEKTAFNASRVAASEEAVLTEWF 386 K +L G+AWR+++W +V T++ VL + + F +LT+W+ Sbjct: 278 KGSLTGLAWRTTLWDIV--TKVKSHGFGIVLLYMVTLSIFPGYITEDVHSELLTDWY 332 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -1 Query: 503 YHKNFHQIHRHSPFRRYRKDRVQCK*SRRKRGSRLDR 393 YH + H HS RR KDR +C R R +R Sbjct: 245 YHSHRSSAHTHSSHRRRSKDREECS-REESRSDRKER 280 >At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:4586626 Length = 1207 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 437 ERGLFCNGEKDCGDGSDENSCDIDNDPNRAPPCDS 541 +RGL CN ++ G+GSDE+ ++ DP + C S Sbjct: 935 KRGL-CNDLRNRGNGSDESHDCLEIDPTQFDTCSS 968 >At1g08890.1 68414.m00989 sugar transporter family protein similar to sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 464 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 363 ILRSLFLSLQFFTASFQSQVCFSISKNKPAGQRIAC---IPEAVHWM 232 +L+S +SL FFT +F ++ P G ++ C IPE+ W+ Sbjct: 160 LLQSFGISLMFFTGNFFHWRTLALLSAIPCGIQMICLFFIPESPRWL 206 >At5g50070.1 68418.m06200 invertase/pectin methylesterase inhibitor family protein low similarity to pollen-specific protein Bnm1 [Brassica napus] GI:1857671; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 183 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 323 AVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDS 427 A K+ N K +P L T+ CQ+ F++ GDS Sbjct: 82 AKKSASFANGAAKKEPSLKTQFQTCQEAFVSIGDS 116 >At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-glucan glucanohydrolase, putative similar to SP|P17859 Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) {Vigna mungo}, alpha-amylase [Malus x domestica] GI:7532799; contains Pfam profile PF00128: Alpha amylase, catalytic domain Length = 887 Score = 28.3 bits (60), Expect = 3.8 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +3 Query: 60 WPRASCSPARLLMVTDGGDKLTRRQRKMKAWNKNYARTRTPANGSGWWPARATT 221 W A+ A VT G T Q K + W + + + P GWWP+RA T Sbjct: 717 WINATSGAAGAFDVTTKGILHTALQ-KCEYWRLSDPKGKPPGV-VGWWPSRAVT 768 >At5g12120.1 68418.m01423 ubiquitin-associated (UBA)/TS-N domain-containing protein contains Pfam profile PF00627: UBA/TS-N domain Length = 619 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 159 NYARTRTPANGSGWWPARATTVATSSSVLP 248 N + T A GSGW PA + A S+ LP Sbjct: 421 NASFTGAAAAGSGWHPANRSEAAQSNGYLP 450 >At3g27840.1 68416.m03472 50S ribosomal protein L12-2, chloroplast (CL12-B) identical to ribosomal protein L12 GB:X68046 [Arabidopsis thaliana] (J. Biol. Chem. 269 (10), 7330-7336 (1994)) Length = 193 Score = 27.5 bits (58), Expect = 6.7 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 327 TASFQSQVCFSISKNK-PAGQRIACIPEAVHWMTSRQLSPS 208 TAS + Q F + N P G RIA I A+ MTS LS S Sbjct: 117 TASVERQTTFDVVINDVPRGNRIAVIT-AIRAMTSLSLSES 156 >At1g29790.1 68414.m03642 expressed protein Length = 378 Score = 27.5 bits (58), Expect = 6.7 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = +3 Query: 114 DKLTRRQRKMKAWNKNYARTRTPANGSGWWPARATTVATSSSVLPREYKLYVARPVCSSI 293 D L R+ ++A N+ T P + +RA ++SSS P+E +Y +S Sbjct: 50 DHLLRQLHTIRA-AINHLTTHQPDKSTSTSTSRAAVSSSSSSTAPKELLIYSKLSPIASA 108 Query: 294 LRNRP 308 N P Sbjct: 109 CHNYP 113 >At3g54570.1 68416.m06038 calmodulin-binding protein-related contains similarity to potato calmodulin-binding protein PCBP GI:17933110 from [Solanum tuberosum] Length = 417 Score = 27.1 bits (57), Expect = 8.9 Identities = 20/47 (42%), Positives = 23/47 (48%) Frame = +2 Query: 299 KQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIE 439 K+ DWK+A K KER IK +L TEE L C CIE Sbjct: 301 KEAEDWKEADGE---KVKER-IKLVLKTEEALLSLAQKPCNREECIE 343 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,913,986 Number of Sequences: 28952 Number of extensions: 247578 Number of successful extensions: 885 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -