BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0976 (498 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11E3.07 |vma4||V-type ATPase subunit E|Schizosaccharomyces p... 68 7e-13 SPBC215.10 |||haloacid dehalogenase-like hydrolase|Schizosacchar... 27 1.6 SPAC3H1.01c |orp3|orc3, SPAP14E8.06c|origin recognition complex ... 25 4.8 SPAC3G9.13c |msw1||mitochondrial tryptophan-tRNA ligase Msw1 |Sc... 25 4.8 SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces po... 25 6.3 SPAC17C9.11c |||zinc finger protein, zf-C2H2 type/UBA domain pro... 25 6.3 SPBC4F6.11c |||asparagine synthase |Schizosaccharomyces pombe|ch... 25 8.4 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 25 8.4 >SPAC11E3.07 |vma4||V-type ATPase subunit E|Schizosaccharomyces pombe|chr 1|||Manual Length = 227 Score = 68.1 bits (159), Expect = 7e-13 Identities = 40/151 (26%), Positives = 73/151 (48%) Frame = +3 Query: 39 LSDAYVQKQIKHMMAFIEQXXXXXXXXXXXXXXXXFNIEKGRLVQQQRLKIMXXXXXXXX 218 LSD VQ ++ M++FI+Q F +EK ++V++Q I Sbjct: 3 LSDEQVQAEMHKMVSFIKQEALEKAKEIHTLSEEEFQVEKAKIVREQCDAIDQTYDMKLK 62 Query: 219 XXXXXXXIQSSNMLNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQ 398 I SN+LN++RL++L ++ + ++ K+L + + Y++ + LIVQ Sbjct: 63 RASMAQKIAKSNVLNKSRLEILNSKQKVIDDIFSRVEKKLDGIEQKKDAYTKFMADLIVQ 122 Query: 399 ALFQLMEPTVTIRVRQTDKALVESLLGKAQQ 491 A+ L EP + RQ D +V++ + KA + Sbjct: 123 AMELLGEPVGIVYSRQRDAEIVKAAIPKATE 153 >SPBC215.10 |||haloacid dehalogenase-like hydrolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 27.1 bits (57), Expect = 1.6 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 297 DHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEP 422 D N L+EA+KRLA +P D E+ +T + F+++ P Sbjct: 181 DDDTNGLEEAKKRLAGIPSD-----EVALTQALPQTFEIIPP 217 >SPAC3H1.01c |orp3|orc3, SPAP14E8.06c|origin recognition complex subunit Orp3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 25.4 bits (53), Expect = 4.8 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -2 Query: 428 DSGFHELEESLHNKCDQQL*VQF-GVLWHFSQALASFIKYITYVIFTHFQYLQTSLVQHV 252 +S F +EESL K + F + + S ++ I+ I Y I THF S+++H+ Sbjct: 241 ESLFTSIEESLSLKFGWRTRRFFRSMFYERSWSVERVIECIRYSILTHFYGNALSIIEHL 300 >SPAC3G9.13c |msw1||mitochondrial tryptophan-tRNA ligase Msw1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 25.4 bits (53), Expect = 4.8 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 309 YVRDLHALSVPSDEL 265 +V DLHAL+VP D L Sbjct: 56 FVADLHALTVPQDPL 70 >SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 793 Score = 25.0 bits (52), Expect = 6.3 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +1 Query: 448 PTRLWWSPCSEKL 486 P+ +WWSP S+K+ Sbjct: 228 PSTIWWSPDSDKI 240 >SPAC17C9.11c |||zinc finger protein, zf-C2H2 type/UBA domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 240 Score = 25.0 bits (52), Expect = 6.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +3 Query: 255 MLNQARLKVL-KVREDHVRNVLDEARKRLAEVPKDTK 362 M +QARL+ L K+R+ + ++ +K LAE+ +D K Sbjct: 92 MQDQARLRDLQKIRQQKAEDA-EQRKKILAEIERDKK 127 >SPBC4F6.11c |||asparagine synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 24.6 bits (51), Expect = 8.4 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 252 SKIGSSSEVQPASPSFHSI 196 S +G+SS+ + P FHS+ Sbjct: 164 SSVGNSSDFREVEPGFHSV 182 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 24.6 bits (51), Expect = 8.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 446 LTDADGDSGFHELEESLHNKCDQQL*VQFGV 354 + D+ +SG HE+ + L N DQQL Q + Sbjct: 507 ILDSLRESGIHEVIQLLRNFPDQQLEKQLNI 537 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,727,235 Number of Sequences: 5004 Number of extensions: 29529 Number of successful extensions: 98 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -