BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0976 (498 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 27 0.47 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 27 0.47 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 3.3 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 24 3.3 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 3.3 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 4.4 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 4.4 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 4.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.6 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 26.6 bits (56), Expect = 0.47 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 307 VMYLMKLASAWLKCQRTPNCTQSCWSHLLC 396 V Y L +A C TPN T + WSH C Sbjct: 170 VEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 26.6 bits (56), Expect = 0.47 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 307 VMYLMKLASAWLKCQRTPNCTQSCWSHLLC 396 V Y L +A C TPN T + WSH C Sbjct: 170 VEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.8 bits (49), Expect = 3.3 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -1 Query: 321 HQVHYVRDLHALSVPSDELGSACSKIGSSSEVQPASPSFHS 199 +Q+H+ H + PS E G+A EV FHS Sbjct: 505 YQLHHQMSYHNMFTPSREPGTAWRCRSCGKEVTNRWHHFHS 545 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 407 PAHGTHCHHPRPSNRQGSGG 466 P H TH HH + G GG Sbjct: 230 PTHQTHHHHHHHQHGGGVGG 249 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.8 bits (49), Expect = 3.3 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -1 Query: 321 HQVHYVRDLHALSVPSDELGSACSKIGSSSEVQPASPSFHS 199 +Q+H+ H + PS E G+A EV FHS Sbjct: 481 YQLHHQMSYHNMFTPSREPGTAWRCRSCGKEVTNRWHHFHS 521 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.8 bits (49), Expect = 3.3 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 134 RGGVQHRKGPSCPAATSQDYGIL*KEGEAG*TSEEDPIFEHAEPSS 271 RGG R P+ P ++ + I+ KE A ++ P F+ A P S Sbjct: 176 RGGAAIRTAPASPFPSAPNQQIIYKEQTANLQVQKVPAFQ-AMPES 220 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 407 PAHGTHCHHPRPSNRQGSGG 466 P H TH HH + G GG Sbjct: 278 PTHQTHHHHHHHQHGGGVGG 297 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 407 PAHGTHCHHPRPSNRQGSGG 466 P H TH HH + G GG Sbjct: 278 PTHQTHHHHHHHQHGGGVGG 297 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 273 DELGSACSKIGSS 235 D LGSACS++ SS Sbjct: 72 DSLGSACSQLSSS 84 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 7.6 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 270 RLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTL 389 RLK+LK+ ++ + V D+A L E+ + L S LV L Sbjct: 270 RLKMLKIHDNEISMVGDKALSGLNEL-QILDLSSNKLVAL 308 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,127 Number of Sequences: 2352 Number of extensions: 8287 Number of successful extensions: 24 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -