BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0972 (539 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 24 1.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 24 1.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 6.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 6.1 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 417 LRPLHIADPAPAELDSFALYEGEDIYEAL 503 L LHIA P ++DS + ED + ++ Sbjct: 522 LHYLHIAGPGKIQMDSSTNFGREDFWNSI 550 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 417 LRPLHIADPAPAELDSFALYEGEDIYEAL 503 L LHIA P ++DS + ED + ++ Sbjct: 522 LHYLHIAGPGKIQMDSSTNFGREDFWNSI 550 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 6.1 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -1 Query: 212 RFELGVKLLIGRRECAWLQIISKYPISIEVKSIIPIRYSIIKWFVV 75 RF G++ +IG C W +I + I+ + ++IIK+ V Sbjct: 474 RFYDGIRDMIGYYPCCWWKIC--WTITTPAICVGVFTFNIIKFVPV 517 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 6.1 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -1 Query: 212 RFELGVKLLIGRRECAWLQIISKYPISIEVKSIIPIRYSIIKWFVV 75 RF G++ +IG C W +I + I+ + ++IIK+ V Sbjct: 527 RFYDGIRDMIGYYPCCWWKIC--WTITTPAICVGVFTFNIIKFVPV 570 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,485 Number of Sequences: 438 Number of extensions: 2447 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -