BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0970 (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33371| Best HMM Match : SRF-TF (HMM E-Value=2.4e-24) 35 0.043 SB_44934| Best HMM Match : UPF0061 (HMM E-Value=0.0055) 27 8.7 SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_33371| Best HMM Match : SRF-TF (HMM E-Value=2.4e-24) Length = 333 Score = 34.7 bits (76), Expect = 0.043 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +1 Query: 343 CVYDYICM*IYEYIIVNIYRYMCKLYNIIIMI*YCVHCCVLFS 471 C+Y Y+C IY Y+ +Y Y+C L + + + + CV F+ Sbjct: 249 CIYAYLCTRIYAYVCACVYDYVCTL-RLRLFVHLRLRLCVHFA 290 Score = 33.5 bits (73), Expect = 0.10 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 331 VFLCCVYDYICM*IYEYIIVNIYRYMC 411 +F CVY + C IY Y+ IY Y+C Sbjct: 237 MFALCVYAHACTCIYAYLCTRIYAYVC 263 >SB_44934| Best HMM Match : UPF0061 (HMM E-Value=0.0055) Length = 270 Score = 27.1 bits (57), Expect = 8.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 282 QPESCKWSMDLIKYSVHDCIYLGDRVL 202 QPE CKW++ + ++HD + + DR L Sbjct: 239 QPEICKWNLMKLGEAIHDALSV-DRSL 264 >SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2992 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -2 Query: 459 TTMYTILYHDNNIIKFTHISIYIHYNILVYSH 364 T +Y LYH N+I + + Y YN+ + ++ Sbjct: 2407 TKIYQDLYHGNSITRIEGLESYTLYNVTIRAY 2438 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,529,021 Number of Sequences: 59808 Number of extensions: 218888 Number of successful extensions: 456 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -