BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0970 (502 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119001-1|AAM50861.1| 503|Drosophila melanogaster LP02983p pro... 29 4.7 AE014134-3196|AAF53870.1| 651|Drosophila melanogaster CG10730-P... 29 4.7 >AY119001-1|AAM50861.1| 503|Drosophila melanogaster LP02983p protein. Length = 503 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +2 Query: 146 KYFKFINVT---CKQCSRILTVNTLSPRYIQS*TEYLIRSI 259 K FK N T + CS I T N L P +++ T+Y +R + Sbjct: 127 KRFKKANYTTAFAEDCSSISTFNYLKPGFVKQPTDYYLRPL 167 >AE014134-3196|AAF53870.1| 651|Drosophila melanogaster CG10730-PA protein. Length = 651 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +2 Query: 146 KYFKFINVT---CKQCSRILTVNTLSPRYIQS*TEYLIRSI 259 K FK N T + CS I T N L P +++ T+Y +R + Sbjct: 275 KRFKKANYTTAFAEDCSSISTFNYLKPGFVKQPTDYYLRPL 315 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,941,312 Number of Sequences: 53049 Number of extensions: 306213 Number of successful extensions: 531 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1784022528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -