BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0970 (502 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 3.1 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 7.2 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 21 7.2 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.2 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 173 CKQCSRILTVNTLSPRYIQS 232 C+ C++ILT T R+IQ+ Sbjct: 5 CEPCNKILTSLTRLRRHIQN 24 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 392 IYIDICVNFIILLS*YNIVYIVVCYFR 472 + +DI V + +S ++ Y + CYFR Sbjct: 32 VEVDIMVRSMGPISEVDMTYSMDCYFR 58 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 334 FLCCVYDYICM*IYEYIIVN 393 F CV DY+ I +Y+I N Sbjct: 117 FSRCVIDYVKFHITQYMISN 136 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 331 VFLCCVYDYICM*IYEYIIVNIYRYMCKLYNI 426 ++ CC D M +YE+ I Y + Y I Sbjct: 230 MYACCPNDTYPMIVYEFSISRHYGILHATYVI 261 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,802 Number of Sequences: 438 Number of extensions: 2357 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -