BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0969 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.15 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 33 0.26 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 29 2.5 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 28 5.7 SB_48151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 28 5.7 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 7.5 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 28 7.5 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 7.5 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 7.5 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 9.9 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 9.9 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 9.9 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 27 9.9 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 27 9.9 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 35.9 bits (79), Expect = 0.028 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = -2 Query: 138 LVAHRNNKHMLICMLMYHKHLNVPNAIQHRALPPRADSCSPGDPLV 1 L H N + L L H P+ +QH A+P ++SCSPGDPLV Sbjct: 7 LSKHTNKIYFLPAKLKVHL---APDPMQH-AIPALSNSCSPGDPLV 48 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 33.5 bits (73), Expect = 0.15 Identities = 19/35 (54%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = -2 Query: 96 LMYHKHLNVPNAIQHR--ALPPR-ADSCSPGDPLV 1 L+ H+ L+ QHR ALPP ++SCSPGDPLV Sbjct: 140 LLQHR-LSASKLPQHRVSALPPHLSNSCSPGDPLV 173 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.20 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 60 IQHRALPPRADSCSPGDPLV 1 I H L P ++SCSPGDPLV Sbjct: 13 IPHELLAPTSNSCSPGDPLV 32 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 69 PNAIQHRALPPRADSCSPGDPLV 1 PN I+ P ++SCSPGDPLV Sbjct: 36 PNEIKKPIFKPTSNSCSPGDPLV 58 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 51 RALPPRADSCSPGDPLV 1 R +PP ++SCSPGDPLV Sbjct: 54 RTIPPVSNSCSPGDPLV 70 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.46 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 48 ALPPRADSCSPGDPLV 1 ALP +++SCSPGDPLV Sbjct: 10 ALPQKSNSCSPGDPLV 25 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.61 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -2 Query: 69 PNAIQHRALP--PRADSCSPGDPLV 1 P+ + R P PR++SCSPGDPLV Sbjct: 4 PSVWEQRRKPARPRSNSCSPGDPLV 28 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.1 bits (67), Expect = 0.81 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 45 LPPRADSCSPGDPLV 1 LP R++SCSPGDPLV Sbjct: 56 LPRRSNSCSPGDPLV 70 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 45 LPPRADSCSPGDPLV 1 +P R++SCSPGDPLV Sbjct: 13 IPKRSNSCSPGDPLV 27 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 PR++SCSPGDPLV Sbjct: 2 PRSNSCSPGDPLV 14 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 66 NAIQHRALPPRADSCSPGDPLV 1 NA H A ++SCSPGDPLV Sbjct: 43 NANPHEASRSASNSCSPGDPLV 64 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 PR++SCSPGDPLV Sbjct: 21 PRSNSCSPGDPLV 33 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 PR++SCSPGDPLV Sbjct: 68 PRSNSCSPGDPLV 80 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 54 HRALPPRADSCSPGDPLV 1 ++ LP ++SCSPGDPLV Sbjct: 14 YKVLPAPSNSCSPGDPLV 31 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 78 LNVPNAIQHRALPPRADSCSPGDPLV 1 +N P+ QH R++SCSPGDPLV Sbjct: 82 INQPSMSQHA----RSNSCSPGDPLV 103 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 PPRADSCSPGDPLV 1 P R++SCSPGDPLV Sbjct: 43 PARSNSCSPGDPLV 56 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 78 LNVPNAIQHRALPPRADSCSPGDPLV 1 ++VP + R+ ++SCSPGDPLV Sbjct: 1 MSVPRDRRERSASQVSNSCSPGDPLV 26 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/22 (59%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -1 Query: 64 CNSA*GTASSC-RFLQPGGSTS 2 C++A T+++C FLQPGGSTS Sbjct: 2 CSTAVDTSTACIEFLQPGGSTS 23 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 PPRADSCSPGDPLV 1 P R++SCSPGDPLV Sbjct: 15 PHRSNSCSPGDPLV 28 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 60 IQHRALPPRADSCSPGDPLV 1 +++R R++SCSPGDPLV Sbjct: 23 LRYRICRERSNSCSPGDPLV 42 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 69 PNAIQHRALPPRADSCSPGDPLV 1 PN I R++SCSPGDPLV Sbjct: 28 PNQIWKNHKNYRSNSCSPGDPLV 50 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 75 NVPNAIQH-RALPPRADSCSPGDPLV 1 N+ N I+ R L ++SCSPGDPLV Sbjct: 12 NILNKIKETRHLQAASNSCSPGDPLV 37 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -2 Query: 126 RNNKH--MLICMLMYHKHLNVPNAIQHRALPPRADSCSPGDPLV 1 R +H +L+C+ H H + +HR L ++SCSPGDPLV Sbjct: 11 RGKQHPAILVCIRCLHIH-GLQG--EHRVLT--SNSCSPGDPLV 49 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = -2 Query: 63 AIQHRALPPRADSCSPGDPLV 1 A++ ++ +++SCSPGDPLV Sbjct: 14 AVERPSVASQSNSCSPGDPLV 34 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 51 RALPPRADSCSPGDPLV 1 + L R++SCSPGDPLV Sbjct: 553 KILSDRSNSCSPGDPLV 569 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P+++SCSPGDPLV Sbjct: 30 PQSNSCSPGDPLV 42 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 PPRADSCSPGDPLV 1 P R++SCSPGDPLV Sbjct: 14 PFRSNSCSPGDPLV 27 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 45 LPPRADSCSPGDPLV 1 L P ++SCSPGDPLV Sbjct: 22 LSPGSNSCSPGDPLV 36 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 42 PPRADSCSPGDPLV 1 P R++SCSPGDPLV Sbjct: 52 PFRSNSCSPGDPLV 65 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 48 ALPPRADSCSPGDPLV 1 +L R++SCSPGDPLV Sbjct: 20 SLRSRSNSCSPGDPLV 35 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 3 LVDPPGCRNRHEEA 44 LVDPPGCRN E A Sbjct: 15 LVDPPGCRNSMENA 28 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 66 NAIQHRALPPRADSCSPGDPLV 1 +AIQ + ++SCSPGDPLV Sbjct: 181 SAIQRKQPACSSNSCSPGDPLV 202 >SB_48151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 461 HFTGF*MFYDNNISKYILFKRCDLNLTRKCCENLEFPSTSKI 586 H +G+ M Y NN +KY+L K C L C ++ P+ KI Sbjct: 196 HISGWAMKYTNNHNKYVLKKTCVGVLL--CSKDCTLPNGLKI 235 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 54 HRALPPRADSCSPGDPLV 1 +R R++SCSPGDPLV Sbjct: 4 YRVKRTRSNSCSPGDPLV 21 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -2 Query: 87 HKHLNVPNAIQHRALPPRADSCSPGDPLV 1 H+ L + A PP ++SCSPGDPLV Sbjct: 81 HQELELAADALGDAQPP-SNSCSPGDPLV 108 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 1/15 (6%) Frame = -2 Query: 42 PPRA-DSCSPGDPLV 1 PP+A +SCSPGDPLV Sbjct: 4 PPQASNSCSPGDPLV 18 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = -2 Query: 111 MLICMLMYHKHL----NVPNAIQHRALPPRADSCSPGDPLV 1 M +C L+ H V + IQ + ++SCSPGDPLV Sbjct: 1 MKVCELIEGAHTWTSRAVTSHIQKKGAKEISNSCSPGDPLV 41 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -2 Query: 66 NAIQHRALPPR-ADSCSPGDPLV 1 N +L PR ++SCSPGDPLV Sbjct: 15 NGTNGASLVPRPSNSCSPGDPLV 37 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 61 NSA*GTASSCRFLQPGGSTS 2 NS T SS FLQPGGSTS Sbjct: 17 NSFNRTDSSIEFLQPGGSTS 36 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 9 PASNSCSPGDPLV 21 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 140 PSSNSCSPGDPLV 152 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 15 PTSNSCSPGDPLV 27 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 3 LVDPPGCRNRHEEA 44 LVDPPGCRN EA Sbjct: 15 LVDPPGCRNSIHEA 28 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 45 LPPRADSCSPGDPLV 1 +P ++SCSPGDPLV Sbjct: 7 MPRASNSCSPGDPLV 21 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 48 ALPPRADSCSPGDPLV 1 A P ++SCSPGDPLV Sbjct: 7 AQPVTSNSCSPGDPLV 22 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 60 IQHRALPPRADSCSPGDPLV 1 ++HR R++SCSPGDPLV Sbjct: 104 LKHR--DQRSNSCSPGDPLV 121 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 45 LPPRADSCSPGDPLV 1 L P ++SCSPGDPLV Sbjct: 61 LRPVSNSCSPGDPLV 75 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 75 NVPNAIQHRALPPRADSCSPGDPLV 1 N+ + P ++SCSPGDPLV Sbjct: 12 NIVGVTTRESTPFGSNSCSPGDPLV 36 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 81 HLNVPNAIQHRALPPRADSCSPGDPLV 1 HL NA P ++SCSPGDPLV Sbjct: 11 HLTT-NAATRVRFPLISNSCSPGDPLV 36 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 111 MLICMLMYHKHLNVPNAIQHRALPPRADSCSPGDPLV 1 M +C ++ LN + R++SCSPGDPLV Sbjct: 1 MYLCRII--SELNQSTRGDSPIVEKRSNSCSPGDPLV 35 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 3 LVDPPGCRNRHEEAVPYA 56 LVDPPGCRN V Y+ Sbjct: 15 LVDPPGCRNSMNANVSYS 32 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 48 ALPPRADSCSPGDPLV 1 A P ++SCSPGDPLV Sbjct: 17 AAPLASNSCSPGDPLV 32 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -2 Query: 111 MLICMLMYHKHLNVPNAIQHRALPPRADSCSPGDPLV 1 +LI + ++ + V +AI + ++SCSPGDPLV Sbjct: 9 LLIIIFIFIAIIVVVSAINIICICTVSNSCSPGDPLV 45 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 5 PTSNSCSPGDPLV 17 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 18 PASNSCSPGDPLV 30 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 45 LPPRADSCSPGDPLV 1 +P ++SCSPGDPLV Sbjct: 11 IPKPSNSCSPGDPLV 25 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 182 PPSNSCSPGDPLV 194 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 16 PPSNSCSPGDPLV 28 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 381 RSNSCSPGDPLV 392 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 84 KHLNVPNAIQHRALPPRADSCSPGDPLV 1 + L +P + L ++SCSPGDPLV Sbjct: 14 RSLGLPAVLGAPELLTASNSCSPGDPLV 41 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 13 RSNSCSPGDPLV 24 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 63 PLSNSCSPGDPLV 75 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 875 RSNSCSPGDPLV 886 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 24 PGSNSCSPGDPLV 36 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 66 RSNSCSPGDPLV 77 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 16 PLSNSCSPGDPLV 28 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 63 RSNSCSPGDPLV 74 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 19 PPSNSCSPGDPLV 31 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 6 RSNSCSPGDPLV 17 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 39 PPSNSCSPGDPLV 51 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 3/24 (12%) Frame = -2 Query: 63 AIQHRALPPR---ADSCSPGDPLV 1 AI++ +L P ++SCSPGDPLV Sbjct: 20 AIENSSLKPTFSISNSCSPGDPLV 43 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 20 RSNSCSPGDPLV 31 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -2 Query: 111 MLICMLMYHKHLNVPNAIQHRALPPRADSCSPGDPLV 1 M + ++M N+P+ H + P ++SCSPGDPLV Sbjct: 91 MTMVLMMTMVSRNIPD---HYSSP--SNSCSPGDPLV 122 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 64 RSNSCSPGDPLV 75 >SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1806 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -3 Query: 440 RIFNNTQATKKSTNH*KPFLITKTGVQIP--RFYGKSSKLATLLFVCKMCER 291 +I + + + H F +T V++ RF G+S +L L+ C++CER Sbjct: 883 KILKGNEDSYTTVRHNFRFNVTTRYVELTVVRFSGESFRLQLELYGCRVCER 934 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 3 LVDPPGCRNRHEEAVPYAELHLVRSDVC 86 LVDPPGCRN ++ + +V C Sbjct: 15 LVDPPGCRNSIKDKGEKESMEIVHVKFC 42 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 44 RSNSCSPGDPLV 55 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 26 RSNSCSPGDPLV 37 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 11 RSNSCSPGDPLV 22 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 138 PGSNSCSPGDPLV 150 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 51 RALPPRADSCSPGDPLV 1 R L ++SCSPGDPLV Sbjct: 8 RQLKKASNSCSPGDPLV 24 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 322 RSNSCSPGDPLV 333 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 25 RSNSCSPGDPLV 36 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 60 RSNSCSPGDPLV 71 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 PPRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 16 PRESNSCSPGDPLV 29 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 4/29 (13%) Frame = -2 Query: 75 NVPNAIQHRALPPRA----DSCSPGDPLV 1 N+P ++ L PRA +SCSPGDPLV Sbjct: 12 NIPT--RYAILSPRARLVSNSCSPGDPLV 38 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 PPRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 62 PETSNSCSPGDPLV 75 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 71 PPSNSCSPGDPLV 83 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 55 RSNSCSPGDPLV 66 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 214 RSNSCSPGDPLV 225 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 39 PRADSCSPGDPLV 1 P ++SCSPGDPLV Sbjct: 11 PGSNSCSPGDPLV 23 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 19 RSNSCSPGDPLV 30 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 1 RSNSCSPGDPLV 12 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 35 RSNSCSPGDPLV 46 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 36 RADSCSPGDPLV 1 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,004,982 Number of Sequences: 59808 Number of extensions: 329127 Number of successful extensions: 2251 Number of sequences better than 10.0: 132 Number of HSP's better than 10.0 without gapping: 2183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2251 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -