SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0969
         (649 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-P...    31   1.8  

>AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-PB,
           isoform B protein.
          Length = 1700

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = -2

Query: 129 HRNNKHMLICMLMYHKHLNVPNAIQHRALPPRADSCSP 16
           H   +  L+  + +H HL  P+A+ H  LPP   +  P
Sbjct: 93  HPQQQLALMAAMQHHHHLPPPHALHHAPLPPPPPNLPP 130


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,481,857
Number of Sequences: 53049
Number of extensions: 492357
Number of successful extensions: 815
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 805
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 815
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2744900550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -