BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0969 (649 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L23110-1|AAA03544.1| 744|Caenorhabditis elegans BMP receptor pr... 28 5.0 AF047651-12|AAN63460.1| 592|Caenorhabditis elegans Abnormal dau... 28 5.0 AF047651-10|AAC02726.1| 744|Caenorhabditis elegans Abnormal dau... 28 5.0 Z79599-1|CAB01871.4| 493|Caenorhabditis elegans Hypothetical pr... 27 8.7 Z79597-3|CAB01862.4| 493|Caenorhabditis elegans Hypothetical pr... 27 8.7 >L23110-1|AAA03544.1| 744|Caenorhabditis elegans BMP receptor protein. Length = 744 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 93 MYHKHLNVPNAIQHRALPPRADSCSPGDPL 4 M H H + P+ QH + P DSC P P+ Sbjct: 637 MQHYHASSPSKRQHPSPNPFFDSCPPPPPI 666 >AF047651-12|AAN63460.1| 592|Caenorhabditis elegans Abnormal dauer formation protein4, isoform c protein. Length = 592 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 93 MYHKHLNVPNAIQHRALPPRADSCSPGDPL 4 M H H + P+ QH + P DSC P P+ Sbjct: 485 MQHYHASSPSKRQHPSPNPFFDSCPPPPPI 514 >AF047651-10|AAC02726.1| 744|Caenorhabditis elegans Abnormal dauer formation protein4, isoform a protein. Length = 744 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 93 MYHKHLNVPNAIQHRALPPRADSCSPGDPL 4 M H H + P+ QH + P DSC P P+ Sbjct: 637 MQHYHASSPSKRQHPSPNPFFDSCPPPPPI 666 >Z79599-1|CAB01871.4| 493|Caenorhabditis elegans Hypothetical protein C33A11.4 protein. Length = 493 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +1 Query: 286 VSLSHILQTKSSVASLEDFP*NLGIWTPVLVIKNGF*WLVDFLVAWVL 429 +S + +L+T+ + + + P N + +K+ WLVD +VAW+L Sbjct: 102 ISNNKVLRTRMNNTAYKPIPNNEKVDLARFRVKDPNEWLVDDVVAWML 149 >Z79597-3|CAB01862.4| 493|Caenorhabditis elegans Hypothetical protein C33A11.4 protein. Length = 493 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +1 Query: 286 VSLSHILQTKSSVASLEDFP*NLGIWTPVLVIKNGF*WLVDFLVAWVL 429 +S + +L+T+ + + + P N + +K+ WLVD +VAW+L Sbjct: 102 ISNNKVLRTRMNNTAYKPIPNNEKVDLARFRVKDPNEWLVDDVVAWML 149 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,943,554 Number of Sequences: 27780 Number of extensions: 266651 Number of successful extensions: 455 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -