BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0967 (590 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.08c |its8||pig-N |Schizosaccharomyces pombe|chr 2|||Manual 30 0.29 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 26 3.6 SPAC23G3.12c |||serine protease |Schizosaccharomyces pombe|chr 1... 25 8.3 SPAC23H3.10 |ssr2||SWI/SNF and RSC complex subunit Ssr2|Schizosa... 25 8.3 SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomy... 25 8.3 SPBC4F6.09 |str1||siderophore-iron transporter Str1 |Schizosacch... 25 8.3 SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual 25 8.3 >SPBC839.08c |its8||pig-N |Schizosaccharomyces pombe|chr 2|||Manual Length = 935 Score = 29.9 bits (64), Expect = 0.29 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 486 NLLFFYYLSVIYYVICIAFSL 424 +++FF YLS I YVIC FSL Sbjct: 450 SIVFFGYLSWIGYVICFVFSL 470 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 26.2 bits (55), Expect = 3.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 317 LVKKSVISIHFLKSKYELKFPYTGTKYK 400 L + V S FLK+ Y+++F Y T+Y+ Sbjct: 614 LERGQVPSREFLKNVYDIEFIYDNTRYR 641 >SPAC23G3.12c |||serine protease |Schizosaccharomyces pombe|chr 1|||Manual Length = 996 Score = 25.0 bits (52), Expect = 8.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 220 DPKSEDKWRKVQYD 261 D K+E+ WR VQYD Sbjct: 953 DAKAENGWRAVQYD 966 >SPAC23H3.10 |ssr2||SWI/SNF and RSC complex subunit Ssr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 503 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 142 GGPRGRNFIQMKWKELTGILNSDSSGDPKSEDK 240 GG + F++++ K + LN+ PK ED+ Sbjct: 149 GGSSSQEFVKLEEKHYSPSLNAMEQTSPKEEDE 181 >SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomyces pombe|chr 2|||Manual Length = 1142 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 145 GPRGRNFIQMKWKELTGILNSDSSGDP 225 G + +N I W+ TGIL+ S P Sbjct: 95 GSQPQNLICFDWERFTGILDQQSLNSP 121 >SPBC4F6.09 |str1||siderophore-iron transporter Str1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 612 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 501 TAFCLNLLFFYYLSVIYYVICIAFSLIVF*YSF 403 T +C + ++ +L V++Y A I + YSF Sbjct: 381 TFYCWDNYYYSFLQVVHYTSITAAGYISYTYSF 413 >SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual Length = 1097 Score = 25.0 bits (52), Expect = 8.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 510 RNYINSKVSPNTAFRNRIVT*TILEPY 590 R Y++SK+SPNT N V ++E Y Sbjct: 622 RVYVHSKISPNTDTYNEYV--PVMEAY 646 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,234,674 Number of Sequences: 5004 Number of extensions: 42961 Number of successful extensions: 103 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -