BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0967 (590 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21460.1 68414.m02683 nodulin MtN3 family protein contains si... 31 0.76 >At1g21460.1 68414.m02683 nodulin MtN3 family protein contains similarity to MTN3 (nodule development protein) GB:Y08726 GI:1619601 from [Medicago truncatula] Length = 247 Score = 30.7 bits (66), Expect = 0.76 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 1/101 (0%) Frame = -3 Query: 447 VICIAFSLIVF*YSFYLYLVPVYGNFNSYFD-FRK*MLITLFFTSVHARKLTCGYIQTRQ 271 VI + LI Y+ + ++G F+ F L++LF + RKL CG T Sbjct: 78 VIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFALQGNGRKLFCGLAAT-- 135 Query: 270 VTSVVLYLTPFVLTLXXXXXXXXXXXR*LFPLHLYKIATSW 148 V S+++Y +P + L ++ TSW Sbjct: 136 VFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSW 176 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,059,541 Number of Sequences: 28952 Number of extensions: 204605 Number of successful extensions: 467 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -