BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0966 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 24 3.6 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 8.4 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.4 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 24.2 bits (50), Expect = 3.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 483 CPTSRNEANEVNLFCQTCDYDGCNGAAT 566 CP + NE C TC+ C+G +T Sbjct: 205 CPITTCGRNEALQACGTCNQITCSGIST 232 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.0 bits (47), Expect = 8.4 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +2 Query: 68 LSQLDHSFRSFVRNFVQTIDVSRVFR*PSEFIVHHNGKTI---VSCARFASCAIREGQ*T 238 L + ++ S +R +Q + VSRVF +E + G+T VS SC + + Q T Sbjct: 309 LPRFTMTYSSSLRECLQQLGVSRVFTDQAELPLISRGRTTPLKVSTILQKSCILVDEQGT 368 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 510 EVNLFCQTCDYDGCNGAATIGRTI 581 E NLFC T + CN G + Sbjct: 1621 EFNLFCSTGSSNSCNRPPKAGEVL 1644 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,897 Number of Sequences: 2352 Number of extensions: 11808 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -