BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0949 (591 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 5.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.0 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.0 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +3 Query: 159 SDKMPAYHSTLTDYSQTVGNLAILPLRTSFRG 254 SD+MP + +Y+ + +P+R + G Sbjct: 379 SDRMPVFLLXTLNYTDVXFRILTMPVRDAIAG 410 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 545 RFLLTGRPGIYGVERET 495 RF +T RPG +ER++ Sbjct: 547 RFAVTLRPGSNSIERQS 563 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 545 RFLLTGRPGIYGVERET 495 RF +T RPG +ER++ Sbjct: 547 RFAVTLRPGSNSIERQS 563 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,576 Number of Sequences: 438 Number of extensions: 2591 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -