BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0946 (410 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0816 - 21499417-21499627,21502965-21503317,21505461-215056... 28 3.3 01_06_1076 + 34359922-34360452 28 3.3 05_04_0119 - 18169729-18169887,18170515-18170653,18170728-181709... 27 4.4 01_05_0160 + 18751512-18751960,18752082-18752553 27 4.4 >08_02_0816 - 21499417-21499627,21502965-21503317,21505461-21505649, 21505819-21505973,21506026-21506245 Length = 375 Score = 27.9 bits (59), Expect = 3.3 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = -2 Query: 127 LLVNNPLV---INASVYLLLEYLKSSASKF 47 +LV PL+ +NASV +L+YL SASKF Sbjct: 219 VLVIGPLLQPTVNASVAHILKYLDGSASKF 248 >01_06_1076 + 34359922-34360452 Length = 176 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +3 Query: 231 GVSQNNPN*DRNNEYWRTTSCKQLAAWSKSRKQ 329 G+ +N+ + DRN++ + T+ + L W + R+Q Sbjct: 144 GIDRNDDDLDRNDDDLQMTTARWLRGWWRGRRQ 176 >05_04_0119 - 18169729-18169887,18170515-18170653,18170728-18170974, 18171585-18171968,18172251-18172540,18172884-18173295, 18173409-18173420,18173943-18174135 Length = 611 Score = 27.5 bits (58), Expect = 4.4 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = -3 Query: 276 STHCSCLSLDYFVILQSMLFWFLHYSHYYTLQQNCFTKQHMSEYIKIIYPYSLII 112 S H C + +L F +SHY + +++C + M E +II P II Sbjct: 509 SYHDWCEPFSTYPRTYDLLHAFHIFSHYQSRKEDCSLEDIMLEMDRIIRPEGFII 563 >01_05_0160 + 18751512-18751960,18752082-18752553 Length = 306 Score = 27.5 bits (58), Expect = 4.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 259 TGTMSTGGPQVANNLPPGVNPENNFLPGG 345 TG +TG P A PPG+ ++ PGG Sbjct: 224 TGHQATGNPAAAALGPPGMKHHHHHHPGG 252 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,934,449 Number of Sequences: 37544 Number of extensions: 175638 Number of successful extensions: 395 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -