BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0945 (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.2 SB_57480| Best HMM Match : MFS_1 (HMM E-Value=0.0025) 28 4.8 >SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1741 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/82 (24%), Positives = 36/82 (43%) Frame = -1 Query: 269 NLMFPKRSEGGSLVLNKLIKVYCFFCVITDIAQAKHALITPRSDRFVHKYTRRIYRENND 90 +L + K V+ KL K + C I +K +L + R H+ +I + Sbjct: 802 SLNYSKDDSTVDFVVKKLPKRPGYHCNICGAGFSK-SLTLKKHQRKTHRRKNKILSSAKN 860 Query: 89 VKSQILNDFPHSPRLNPICVSL 24 S+++ FP S +NP +S+ Sbjct: 861 SSSKLMETFPKSKTINPQSISV 882 >SB_57480| Best HMM Match : MFS_1 (HMM E-Value=0.0025) Length = 930 Score = 28.3 bits (60), Expect = 4.8 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +1 Query: 175 AISVITQKKQ*TFINLFNTSDPPSLRFGNIKFYY**LSPAMLSAVIVVPRMTPR 336 +I+VI + + LFNT P S+RFG F + LS A++ V+ R PR Sbjct: 757 SITVIQTLMELSGTLLFNTIYPESMRFGMPGFVF-FLSAAIMFIPFVILRSLPR 809 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,863,523 Number of Sequences: 59808 Number of extensions: 327905 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -