BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0945 (575 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58747-3|AAL27233.2| 420|Caenorhabditis elegans Hypothetical pr... 28 5.5 AC091125-1|AAK27889.2| 313|Caenorhabditis elegans Hypothetical ... 27 9.5 >U58747-3|AAL27233.2| 420|Caenorhabditis elegans Hypothetical protein C55F2.1a protein. Length = 420 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 480 KNVILVYVPYIYSYSCSKKRLFQYYKQTL 566 K+ +L ++ + Y+C KK LFQ KQ + Sbjct: 215 KHFMLSFLQNFHKYNCIKKSLFQLNKQAI 243 >AC091125-1|AAK27889.2| 313|Caenorhabditis elegans Hypothetical protein Y67D2.4 protein. Length = 313 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -1 Query: 194 CVITDIAQAKHALITPRSDRFVHK--YT---RRIYRENNDVKSQILNDFPHSPRLN 42 C + D+ + KH + +R V K +T +R+ R NDVK +L+ ++PR N Sbjct: 54 CDLIDMKKYKHQIEDYYYERGVQKVLFTDCKKRLPRALNDVKLSMLDALENTPRFN 109 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,413,443 Number of Sequences: 27780 Number of extensions: 243773 Number of successful extensions: 555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1194789454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -