BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0939 (445 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom... 27 1.3 SPAC13G7.10 |mug152||transcription factor |Schizosaccharomyces p... 24 9.1 >SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 27.1 bits (57), Expect = 1.3 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -3 Query: 365 NIDKYFFSDTCSFYLI*TGRGLPPKRKA*L--ILSRNQQNSGVIDT 234 ++D++FF D FYL G L + + L IL + +S ++DT Sbjct: 151 SVDEFFFGDCAPFYLAPAGSNLEIDQLSRLVEILEGGEISSEILDT 196 >SPAC13G7.10 |mug152||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 24.2 bits (50), Expect = 9.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 358 SILYGRRISDPLNQVMKSGMIYDS 429 S L G+ +SDP N ++S Y+S Sbjct: 287 SFLLGQSLSDPFNHTLQSFHPYES 310 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,542,969 Number of Sequences: 5004 Number of extensions: 27605 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 162176800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -